Primary Antibodies

Primary antibodies are immunoglobulins that recognize and bind to a specific antigen of interest with high affinity and specificity to purify, detect, and measure that antigen. Includes antibody pairs for specific biochemical applications.

Search Within Results

1,156 – 1,170 of 1,806,396 results

1,156

Invitrogen™ CD8 alpha Recombinant Rabbit Monoclonal Antibody (SI18-01)

Rabbit Recombinant Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles.
Target Species	Human
Host Species	Rabbit
Conjugate	Unconjugated
Applications	Flow Cytometry,Immunohistochemistry (Paraffin),Western Blot,Immunocytochemistry
Form	Liquid
Gene Accession No.	P01732, P10966
Isotype	IgG
Concentration	1 mg/mL
Antigen	CD8 alpha
Gene Symbols	Cd8a, CD8B
Regulatory Status	RUO
Purification Method	Protein A
Gene Alias	BB154331; CD8; CD8 alpha; CD8 alpha chain; CD8 alpha chain precursor; CD8 antigen; CD8 antigen 32 kDa chain; CD8 antigen 37 kDa chain; CD8 antigen alpha polypeptide; CD8 antigen alpha protein; CD8 antigen alpha protein precursor; CD8 antigen alpha-chain; CD8 antigen beta polypeptide; CD8 antigen beta polypeptide precursor; CD8 antigen beta-chain; CD8 antigen, alpha chain; CD8 antigen, alpha polypeptide; CD8 antigen, alpha polypeptide (p32); CD8 antigen, alpha-chain; CD8 antigen, beta chain; CD8 antigen, beta chain 1; CD8 antigen, beta polypeptide; CD8 antigen, beta polypeptide 1 (p37); CD8 antigen, beta-chain; CD8 beta; CD8 beta chain; CD8 beta-2; CD8a; CD8A antigen alpha; CD8a molecule; CD8A; T-cell surface glycoprotein; CD8alpha; CD8B; CD8b antigen; CD8b molecule; CD8b molecule pseudogene; Cd8b1; CD8beta; CD8BP; fCD8; LEU2; Leu-2; Leu2 T-lymphocyte antigen; leu-2a; Ly-2; LY3; Ly-3; Ly-35; Ly-B; Ly-C; Lymphocyte antigen 3; Lyt2; Lyt-2; Lyt-2.1 lymphocyte differentiation antigen (AA at 100); Lyt3; Lyt-3; MAL; membrane glycoprotein; membrane protein; OKT8 T-cell antigen; OX-8 membrane antigen; p32; P37; RHACD8-4; T cell co-receptor; T lymphocyte surface glycoprotein beta chain; T8 T-cell antigen; T-cell antigen Leu2; T-cell membrane glycoprotein Ly-3; T-cell surface glycoprotein; T-cell surface glycoprotein CD8 alpha chain; T-cell surface glycoprotein CD8 beta chain; T-cell surface glycoprotein Lyt-2; T-cell surface glycoprotein Lyt-3; T-cell surface molecule; T-lymphocyte differentiation antigen T8/Leu-2; type I transmembrane glycoprotein
Gene	Cd8a
Product Type	Antibody
Gene ID (Entrez)	925, 926
Formulation	TBS with 0.05% BSA, 40% Glycerol and 0.05% sodium azide; pH 7.4
Immunogen	Synthetic peptide within Human CD8 alpha aa 186-235.
Classification	Recombinant Monoclonal
Primary or Secondary	Primary
Clone	SI18-01

1,157

Invitrogen™ VSV-G Tag Polyclonal Antibody

Rabbit Polyclonal Antibody

Pricing & Availability
Specifications

Content And Storage	4°C
Target Species	Tag
Host Species	Rabbit
Conjugate	Unconjugated
Applications	ELISA,Immunohistochemistry,Immunoprecipitation,Western Blot,Immunocytochemistry
Form	Liquid
Isotype	IgG
Concentration	1 mg/mL
Antigen	VSV-G Tag
Regulatory Status	RUO
Purification Method	Antigen affinity chromatography
Gene Alias	vesicular stomatitis virus; VSIVgp3; VSV epitope tag; VSV tag; vsvg; VSVG epitope tag; VSV-G epitope tag; VSVG tag; YTDIEMNRLGK
Product Type	Antibody
Formulation	PBS with 0.1% sodium azide; pH 7.2
Immunogen	Rabbits were immunized with YTDIEMNRLGK (VSV-g epitope) conjugated with KLH.
Classification	Polyclonal
Primary or Secondary	Primary

1,158

Invitrogen™ VEGF Receptor 1 Recombinant Rabbit Monoclonal Antibody (SY09-09)

Rabbit Recombinant Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles.
Target Species	Human,Mouse,Rat
Host Species	Rabbit
Conjugate	Unconjugated
Applications	Flow Cytometry,Immunohistochemistry (Paraffin),Immunoprecipitation,Western Blot,Immunocytochemistry
Form	Liquid
Gene Accession No.	P17948, P35969, P53767
Isotype	IgG
Concentration	1 mg/mL
Antigen	VEGF Receptor 1
Gene Symbols	FLT1
Regulatory Status	RUO
Purification Method	Protein A
Gene Alias	AI323757; embryonic receptor kinase 2; Emrk2; FLT; FLT1; FLT-1; fms related tyrosine kinase 1; FMS-like tyrosine kinase 1; FMS-related tyrosine kinase 1; Fms-related tyrosine kinase 1 (vascular endothelial growth factor/vascular permeability factor receptor); FRT; i21; sFlt1; soluble VEGFR 1; sVEGFR 1; Tyrosine-protein kinase FRT; tyrosine-protein kinase receptor FLT; Vascular endothelial growth factor receptor 1; vascular endothelial growth factor receptor-1; vascular permeability factor receptor; VEGF R1; VEGFR1; VEGFR-1
Gene	FLT1
Product Type	Antibody
Gene ID (Entrez)	14254, 2321, 54251
Formulation	TBS with 0.05% BSA, 40% Glycerol and 0.05% sodium azide; pH 7.4
Immunogen	Synthetic peptide within Human VEGF Receptor 1 aa 1-50.
Classification	Recombinant Monoclonal
Primary or Secondary	Primary
Clone	SY09-09

1,159

Invitrogen™ NeuN Recombinant Rabbit Monoclonal Antibody (14H6L24)

Rabbit Recombinant Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles.
Target Species	Human,Mouse,Rat
Host Species	Rabbit
Conjugate	Unconjugated
Applications	Immunohistochemistry (Paraffin),Immunoprecipitation,Western Blot,RNA Immunoprecipitation,Immunocytochemistry
Form	Liquid
Gene Accession No.	A6NFN3, Q8BIF2
Isotype	IgG
Concentration	0.5 mg/mL
Antigen	NeuN
Gene Symbols	RBFOX3
Regulatory Status	RUO
Purification Method	Protein A
Gene Alias	D11Bwg0517e; FLJ56884; FLJ58356; fox 1 homolog (C. elegans) 3; fox1 homolog C; Fox-1 homolog C; FOX3; FOX-3; FOX3NeuN; hexaribonucleotide binding protein 3; hexaribonucleotide binding protein 3 (HRNBP3); Hexaribonucleotide-binding protein 3; Hrnbp3; NEUN; NeuN antigen; Neuna60; neuronal nuclear antigen A60; neuronal nuclei; Neuronal nuclei antigen; RBFOX3; RFOX3; RGD1560070; RNA binding fox-1 homolog 3; RNA binding protein; RNA binding protein fox-1 homolog 3; RNA binding protein, fox-1 homolog (C. elegans) 3; RNA binding protein, fox-1 homolog 3
Gene	RBFOX3
Product Type	Antibody
Gene ID (Entrez)	146713, 287847, 52897
Formulation	PBS with 0.09% sodium azide; pH 7.2-7.4
Immunogen	Protein corresponding to Human RBFOX3 (aa 1-312).
Classification	Recombinant Monoclonal
Primary or Secondary	Primary
Clone	14H6L24

1,160

Invitrogen™ DLL3 Recombinant Rabbit Monoclonal Antibody (7H24L4)

Rabbit Recombinant Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles.
Target Species	Human
Host Species	Rabbit
Conjugate	Unconjugated
Applications	Immunocytochemistry
Form	Liquid
Gene Accession No.	Q9NYJ7
Isotype	IgG
Concentration	0.5 mg/mL
Antigen	DLL3
Gene Symbols	Dll3
Regulatory Status	RUO
Purification Method	Protein A
Gene Alias	delta like canonical Notch ligand 3; Delta3; delta-like 3; delta-like 3 (Drosophila); delta-like protein 3; Dll3; Drosophila Delta homolog 3; M-Delta-3; pu; pudgy; SCDO1
Gene	Dll3
Product Type	Antibody
Gene ID (Entrez)	10683
Formulation	PBS with 0.09% sodium azide; pH 7.2-7.4
Immunogen	Protein corresponding to human DLL3 [aa514-aa618].
Classification	Recombinant Monoclonal
Primary or Secondary	Primary
Clone	7H24L4

1,161

Invitrogen™ NEFH Monoclonal Antibody (RMdO-20)

Mouse Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	-20°C
Target Species	Human,Mouse,Rat,Rabbit,Bovine,Hamster,Mollusca
Host Species	Mouse
Conjugate	Unconjugated
Applications	ELISA,Immunohistochemistry (Frozen),Immunohistochemistry (Paraffin),Immunoprecipitation,Western Blot,Immunocytochemistry
Form	Liquid
Gene Accession No.	P12036, P16884, P19246
Isotype	IgG1 κ
Concentration	0.5 mg/mL
Antigen	NEFH
Gene Symbols	Nefh
Regulatory Status	RUO
Purification Method	Purified
Gene Alias	200 kDa neurofilament protein; CMT2CC; heavy neurofilament protein; I79_012512; intermediate filament protein; KIAA0845; LOW QUALITY PROTEIN: neurofilament heavy polypeptide; mKIAA0845; NEF3; Nefh; nefh.L; neurofilament; neurofilament 200kDa; neurofilament heavy; neurofilament heavy L homeolog; neurofilament heavy polypeptide; neurofilament heavy polypeptide-like; neurofilament triplet H protein; neurofilament, heavy polypeptide; neurofilament, heavy polypeptide 200kDa; neurofilament, heavy polypeptide L homeolog; neurofilament-H; NF 200 kD; NF200; Nfh; NF-H; NHC; XELAEV_18007418mg
Gene	Nefh
Product Type	Antibody
Gene ID (Entrez)	100357177, 100753127, 101838568, 24587, 380684, 4744, 528842
Formulation	PBS with 0.1% sodium azide
Immunogen	Adult Rat neurofilaments.
Classification	Monoclonal
Primary or Secondary	Primary
Clone	RMdO-20

1,162

Invitrogen™ Phospho-mTOR (Ser2448) Polyclonal Antibody

Rabbit Polyclonal Antibody

Pricing & Availability
Specifications

Content And Storage	-20°C
Target Species	Human,Mouse
Host Species	Rabbit
Conjugate	Unconjugated
Applications	Western Blot,Immunocytochemistry
Form	Liquid
Gene Accession No.	P42345, Q9JLN9
Isotype	IgG
Antigen	Phospho-mTOR (Ser2448)
Gene Symbols	MTOR
Regulatory Status	RUO
Purification Method	Antigen affinity chromatography
Gene Alias	2610315D21Rik; AI327068; angiopoietin-like factor CDT6; FK506 binding protein 12-rapamycin associated protein 1; FK506 binding protein 12-rapamycin associated protein 2; FK506-binding protein 12-rapamycin complex-associated protein 1; FKBP12-rapamycin complex-associated protein; FKBP12-rapamycin complex-associated protein 1; FKBP-rapamycin associated protein; FKBP-rapamycin associated protein (FRAP); FKBP-rapamycin-associated protein FRAP; flat; FRAP; FRAP1; FRAP2; Mammalian target of rapamycin; mechanistic target of rapamycin; mechanistic target of rapamycin (serine/threonine kinase); mechanistic target of rapamycin kinase; Mtor; m-TOR; mTORC1; Raft1; Rapamycin and FKBP12 target 1; rapamycin and FKBP12 target-1 protein; rapamycin associated protein FRAP2; rapamycin target protein 1; RAPT1; serine/threonine-protein kinase mTOR; SKS
Gene	MTOR
Product Type	Antibody
Gene ID (Entrez)	2475, 56717
Formulation	Dulbecco's PBS with 1mg/mL BSA and 0.05% sodium azide; pH 7.3
Immunogen	The antiserum was produced against a chemically synthesized phosphopeptide derived from the region of human mTOR that contains serine 2448. The sequence is conserved in human, mouse and rat.
Classification	Polyclonal
Primary or Secondary	Primary

1,163

Invitrogen™ Pan Ras Monoclonal Antibody (Ras10)

Mouse Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	-20°C, Avoid Freeze/Thaw Cycles
Target Species	Human,Mouse,Monkey
Host Species	Mouse
Conjugate	Unconjugated
Applications	Flow Cytometry,Immunohistochemistry (Paraffin),Immunoprecipitation,Western Blot,Immunocytochemistry
Form	Liquid
Gene Accession No.	P01111, P01112, P01116, P08556, P32883, Q61411
Isotype	IgG2a
Concentration	1 mg/mL
Antigen	Pan Ras
Gene Symbols	HRAS, KRAS, Nras
Regulatory Status	RUO
Purification Method	Protein G
Gene Alias	AI929937; ALPS4; AV095280; C-BAS/HAS; cellular c-Ki-ras2; cellular c-Ki-ras2 proto-oncogene; CFC2; c-Ha-ras; c-Ha-ras p21 protein; c-Ha-ras transgene; C-HA-RAS1; c-has/bas p21 protein; C-H-RAS; c-Ki-ras; c-Kirsten-ras protein; c-Kirsten-ras proto-oncogene; c-K-ras; c-K-ras2 protein; CMNS; c-rasHa; c-ras-Ki-2 activated oncogene; CTLO; etID18709.8; fa04e08; fc14b12; fc23g10; fj89d12; fj99a10; GTP- and GDP-binding peptide B; GTPase HRas; GTPase HRas, N-terminally processed; GTPase Hras1; GTPase KRas; GTPase KRas, N-terminally processed; GTPase NRas; HAMSV; Ha-ras; Ha-Ras1 proto-oncoprotein; Harvey ras1 protein; Harvey rat sarcoma viral (v-Ha-ras) oncogene homolog; Harvey rat sarcoma viral oncogene homolog; Harvey rat sarcoma viral oncoprotein; Harvey rat sarcoma virus oncogene; Harvey rat sarcoma virus oncogene 1; Harvey-ras; hras; H-ras; H-ras 1 protein; HRas proto-oncogene, GTPase; HRas proto-oncogene, GTPase a; HRAS1; H-Ras-1; Hras-1; hrasa; H-RASIDX; hypothetical protein LOC445289; hypothetical protein LOC550286; K RAS; Ki-ras; Kirsten rat sarcoma oncogene 2, expressed; Kirsten rat sarcoma viral oncogene; Kirsten rat sarcoma viral oncogene homolog; Kirsten rat sarcoma viral oncogene homologue 2 (active); Kras; K-ras; K-Ras 2; K-ras p21 protein; KRAS proto-oncogene, GTPase; KRAS1; KRAS2; Kras-2; K-RAS2A; K-RAS2B; K-RAS4A; K-RAS4B; NCMS; Neuroblastoma RAS; neuroblastoma ras oncogene; neuroblastoma RAS viral (v-ras) oncogene homolog; neuroblastoma RAS viral oncogene homolog; NRAS; N-ras; N-ras oncogene p21; N-ras protein part 4; NRAS proto-oncogene, GTPase; NRAS1; NS; NS3; NS6; oncogene KRAS2; p19 H-RasIDX protein; p21; p21 N-ras oncogene; p21 protein; p21B; p21ras; PR310 c-K-ras oncogene; RALD; ras; Ras family small GTP binding protein H-Ras; RASH1; RASK; RASK2; ras-like protein; RASN; sb:eu826; transformation gene: oncogene HAMSV; transforming protein N-Ras; Transforming protein p21; v-Ha-ras Harvey rat sarcoma viral oncogene homolog; v-Ha-ras Harvey rat sarcoma viral oncogene homolog a; v-Ki-ras2 Kirsten rat sarcoma 2 viral oncogene homolog; v-Ki-ras2 Kirsten rat sarcoma viral oncogene homolog; v-ras neuroblastoma RAS viral oncogene homolog; wu:fa04e08; wu:fc14b12; wu:fc23g10; wu:fj89d12; wu:fj99a10; xRAS1; xRAS2; zgc:100761; zgc:110250; zgc:85725; zras-b1
Gene	HRAS
Product Type	Antibody
Gene ID (Entrez)	15461, 16653, 18176, 3265, 3845, 4893
Formulation	PBS with 1mg/mL BSA, 30% glycerol and 0.05% sodium azide
Immunogen	Purified recombinant Ras protein.
Classification	Monoclonal
Primary or Secondary	Primary
Clone	Ras10

1,164

Invitrogen™ LAMP1 Polyclonal Antibody

Rabbit Polyclonal Antibody

Pricing & Availability
Specifications

Content And Storage	-20°C, Avoid Freeze/Thaw Cycles
Target Species	Human
Host Species	Rabbit
Conjugate	Unconjugated
Applications	Western Blot,Immunocytochemistry
Form	Liquid
Gene Accession No.	P11279
Isotype	IgG
Concentration	1 mg/mL
Antigen	LAMP1
Gene Symbols	LAMP1
Regulatory Status	RUO
Purification Method	Affinity chromatography
Gene Alias	120 kDa lysosomal membrane glycoprotein; AI196048; CD107 antigen-like family member A; CD107a; I79_011073; Lamp I; LAMP1; LAMP-1; LAMPA; LGP120; LGP-120; LGPA; LGP-A; lysosomal associated membrane protein 1; Lysosomal associated membrane protein 1 (120 kDa); lysosomal membrane glycoprotein 1; lysosomal membrane glycoprotein A; lysosomal-associated membrane protein 1; lysosome-associated membrane glycoprotein 1; LYSOSOME-ASSOCIATED MEMBRANE GLYCOPROTEIN 1 PRECURSOR (LAMP-1) (LGP-A) (LGP-120) (CD107A) (P2B); lysosome-associated membrane protein 1; P2B
Gene	LAMP1
Product Type	Antibody
Gene ID (Entrez)	3916
Formulation	PBS with 0.05% sodium azide; pH 7.4
Immunogen	Synthetic peptide corresponding to residues C K(407) R S H A G Y Q T I(416) of human LAMP1.
Classification	Polyclonal
Primary or Secondary	Primary

1,165

Invitrogen™ Ephrin A1 Polyclonal Antibody

Rabbit Polyclonal Antibody

Pricing & Availability
Specifications

Content And Storage	-20°C
Target Species	Human,Mouse
Host Species	Rabbit
Conjugate	Unconjugated
Applications	Immunohistochemistry,Immunoprecipitation,Western Blot,Immunocytochemistry
Form	Liquid
Gene Accession No.	P20827, P52793
Isotype	IgG
Concentration	0.25 mg/mL
Antigen	Ephrin A1
Gene Symbols	EFNA1
Regulatory Status	RUO
Purification Method	Antigen Affinity Chromatography
Gene Alias	AI325262; B61; ECKLG; EFL1; Efna1; Epgl1; EPH-related receptor tyrosine kinase ligand 1; ephrin A1; ephrin-A1; Ephrin-A1, secreted form; Epl1; EPLG1; Immediate early response protein B61; Lerk1; LERK-1; ligand of eph-related kinase 1; TNF alpha-induced protein 4; TNFAIP4; tumor necrosis factor alpha-induced protein 4; tumor necrosis factor, alpha-induced protein 4
Gene	EFNA1
Product Type	Antibody
Gene ID (Entrez)	13636, 1942
Formulation	PBS with 0.1% sodium azide; pH 7.4
Immunogen	Synthetic peptide derived from the C-terminal end of mouse ephrin-A1 protein.
Classification	Polyclonal
Primary or Secondary	Primary

1,166

Invitrogen™ TIA-1 Monoclonal Antibody (OTI1D7)

Mouse Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	-20°C, Avoid Freeze/Thaw Cycles
Target Species	Human,Mouse
Host Species	Mouse
Conjugate	Unconjugated
Applications	Immunohistochemistry (Paraffin),Western Blot,RNA Immunoprecipitation,Immunocytochemistry,Western Blot
Form	Liquid
Gene Accession No.	P31483, P52912
Isotype	IgG2b
Concentration	1 mg/mL
Antigen	TIA-1
Gene Symbols	TIA1
Regulatory Status	RUO
Purification Method	Affinity Chromatography
Gene Alias	2310050N03Rik; AI256674; cytotoxic granule-associated RNA binding protein 1; cytotoxic granule-associated RNA-binding protein 1; mTIA-1; Nucleolysin TIA-1; nucleolysin TIA-1 isoform p40; p40 TIA 1; p40-TIA-1; p40-TIA-1 (containing p15-TIA-1); RNA-binding protein TIA-1; T-cell-restricted intracellular antigen-1; Tia; TIA 1; TIA1; TIA-1; TIA1 cytotoxic granule-associated RNA binding protein; TIA1 protein; TIAL1; TIAR; WDM
Gene	TIA1
Product Type	Antibody
Gene ID (Entrez)	21841, 7072
Formulation	PBS with 1% BSA, 50% glycerol and 0.02% sodium azide; pH 7.3
Immunogen	Full length human recombinant protein of TIA1 produced in HEK293T cell.
Classification	Monoclonal
Primary or Secondary	Primary
Clone	OTI1D7

1,167

Invitrogen™ Influenza A M1 Monoclonal Antibody (GA2B)

Mouse Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles.
Target Species	Virus
Host Species	Mouse
Conjugate	Unconjugated
Applications	Immunohistochemistry (Paraffin),Western Blot,Immunocytochemistry
Form	Liquid
Isotype	IgG1
Concentration	1 mg/mL
Antigen	Influenza A M1
Regulatory Status	RUO
Purification Method	Protein A
Gene Alias	Influenza M1
Product Type	Antibody
Formulation	PBS with <0.1% sodium azide; pH 7.5
Immunogen	Influenza A / Puerto Rico / 8 / 34 (H1N1) and A/Bangkok / 1 / 79 (H3N2) viruses.
Classification	Monoclonal
Primary or Secondary	Primary
Clone	GA2B

1,168

Glucagon Monoclonal Antibody (ICACLS), eFluor™ 570, eBioscience™, Invitrogen™

Mouse Monoclonal Antibody

Pricing & Availability
Specifications

Target Species	Human,Mouse,Rat
Host Species	Mouse
Conjugate	eFluor 570
Applications	Immunohistochemistry (Paraffin),Immunocytochemistry
Form	Liquid
Isotype	IgG1 κ
Gene Accession No.	P01275, P06883, P55095
Concentration	0.2 mg/mL
Antigen	Glucagon
Gene Symbols	Gcg
Regulatory Status	RUO
Purification Method	Affinity chromatography
Gene Alias	GCG; Glicentin; Glicentin-related polypeptide; GLP1; GLP-1; GLP-1(7-36); GLP-1(7-37); GLP1/2; GLP2; GLP-2; Glu; glucagon; Glucagon-like peptide 1; Glucagon-like peptide 1(7-36); Glucagon-like peptide 1(7-37); Glucagon-like peptide 2; glucagon-like peptide-1; GRPP; IL12p35; IL12P40; Incretin hormone; OXM; OXY; Oxyntomodulin; porcine proglucagon; PPG; preproglucagon; proglucagon
Gene	Gcg
Product Type	Antibody
Gene ID (Entrez)	14526, 24952, 2641
Classification	Monoclonal
Primary or Secondary	Primary
Clone	ICACLS

1,169

Invitrogen™ IFNAR2 Monoclonal Antibody (MMHAR-2)

Mouse Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	-20°C, Avoid Freeze/Thaw Cycles
Target Species	Human
Host Species	Mouse
Conjugate	Unconjugated
Applications	Functional Assay,Neutralization
Form	Liquid
Gene Accession No.	P48551
Isotype	IgG2a
Concentration	0.5 mg/mL
Antigen	IFNAR2
Gene Symbols	IFNAR2
Regulatory Status	RUO
Purification Method	Ion-exchange chromatography, Size-exclusion chromatography
Gene Alias	AI747302; human interferon alpha/beta receptor; IFN alpha/betaRbeta; IFN R2; IFNABR; IFNalpha/beta R2; IFN-alpha/beta receptor 2; IFNalpha/betaR2; IFN-alpha/betaR2; IFN-alpha/betaRbeta; IFNalpha/beta-Rbeta; IFN-alpha-REC; IFNAR2; Ifnar-2; IFNARB; IFN-R; IFNR2; IFN-R-2; IMD45; interferon (alpha and beta) receptor 2; interferon (alpha, beta and omega) receptor 2; interferon alpha and beta receptor subunit 2; interferon alpha binding protein; Interferon alpha/beta receptor 2; interferon receptor 2c; interferon-alpha/beta receptor 2; interferon-alpha/beta receptor beta chain; type I interferon alpha/beta receptor 2a; type I interferon receptor 2
Gene	IFNAR2
Product Type	Antibody
Gene ID (Entrez)	3455
Formulation	PBS with 0.1% BSA and no preservative
Immunogen	Human interferon alpha/beta receptor chain 2.
Classification	Monoclonal
Primary or Secondary	Primary
Clone	MMHAR-2

1,170

Invitrogen™ CYP27B1 Polyclonal Antibody

Rabbit Polyclonal Antibody

Pricing & Availability
Specifications

Content And Storage	-20°C
Target Species	Human,Mouse,Rat
Host Species	Rabbit
Conjugate	Unconjugated
Applications	Immunohistochemistry (Paraffin),Western Blot
Form	Lyophilized
Gene Accession No.	O15528, O35084, O35132
Isotype	IgG
Concentration	500 μg/mL
Antigen	CYP27B1
Gene Symbols	CYP27B1
Regulatory Status	RUO
Purification Method	Antigen affinity chromatography
Gene Alias	1alpha(OH)ase; 25 hydroxyvitamin D3-1-alpha hydroxylase; 25(OH)D 1alpha-hydroxylase; 25-hydroxyvitamin D(3) 1-alpha-hydroxylase; 25-hydroxyvitamin D-1 alpha hydroxylase, mitochondrial; 25-hydroxyvitamin D-1 alpha hydroxylase, mitochondrial precursor (25-OHD-1 alpha-hydroxylase) (25-hydroxyvitamin D3 1-alpha-hydroxylase) (VD3 1A hydroxylase) (P450C1 alpha) (P450VD1-alpha); 25-hydroxyvitamin D3 1alpha-hydroxylase; 25-OHD-1 alpha-hydroxylase; Calcidiol 1-monooxygenase; Cp2b; cy; Cyp1; CYP1alpha; Cyp27b; Cyp27b1; Cyp40; cytochrome p450 27B1; cytochrome P450 40 (25-hydroxyvitamin D3 1 alpha-hydroxylase); cytochrome P450 family 27 subfamily B member 1; cytochrome P450 subfamily XXVIIB (25-hydroxyvitamin D-1-alpha-hydroxylase) polypeptide 1; cytochrome P450 subfamily XXVIIB polypeptide 1; cytochrome P450, 27b1; cytochrome P450, 40 (25-hydroxyvitamin D3 1 alpha-hydroxylase); cytochrome P450, family 27, subfamily B, polypeptide 1; cytochrome P450, subfamily 27b, polypeptide 1; cytochrome P450C1 alpha; Cytochrome P450VD1-alpha; P450c1; P450C1 alpha; P450VD1alpha; P450VD1-alpha; Pddr; VD3 1A hydroxylase; Vdd1; Vddr; VDDRI; VDR
Gene	CYP27B1
Product Type	Antibody
Gene ID (Entrez)	114700, 13115, 1594
Formulation	PBS with 5mg BSA and 0.05mg sodium azide
Immunogen	A synthetic peptide corresponding to a sequence at the C-terminus of human CYP27B1 (475-508aa HFEVQPEPGAAPVRPKTRTVLVPERSINLQFLDR).
Classification	Polyclonal
Primary or Secondary	Primary

Primary Antibodies

Filtered Search Results

Narrow Results

Invitrogen™ CD8 alpha Recombinant Rabbit Monoclonal Antibody (SI18-01) Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ VSV-G Tag Polyclonal Antibody Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ VEGF Receptor 1 Recombinant Rabbit Monoclonal Antibody (SY09-09) Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ NEFH Monoclonal Antibody (RMdO-20) Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ Phospho-mTOR (Ser2448) Polyclonal Antibody Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ Pan Ras Monoclonal Antibody (Ras10) GSA/VA ContractAvailable on GSA/VA contract for Federal Government customers.Learn More Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ LAMP1 Polyclonal Antibody Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ Ephrin A1 Polyclonal Antibody Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ TIA-1 Monoclonal Antibody (OTI1D7) Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ Influenza A M1 Monoclonal Antibody (GA2B) Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Glucagon Monoclonal Antibody (ICACLS), eFluor™ 570, eBioscience™, Invitrogen™ Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ IFNAR2 Monoclonal Antibody (MMHAR-2) Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ CYP27B1 Polyclonal Antibody Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ CD8 alpha Recombinant Rabbit Monoclonal Antibody (SI18-01)

Invitrogen™ VSV-G Tag Polyclonal Antibody

Invitrogen™ VEGF Receptor 1 Recombinant Rabbit Monoclonal Antibody (SY09-09)

Invitrogen™ NEFH Monoclonal Antibody (RMdO-20)

Invitrogen™ Phospho-mTOR (Ser2448) Polyclonal Antibody

Invitrogen™ Pan Ras Monoclonal Antibody (Ras10)

Invitrogen™ LAMP1 Polyclonal Antibody

Invitrogen™ Ephrin A1 Polyclonal Antibody

Invitrogen™ TIA-1 Monoclonal Antibody (OTI1D7)

Invitrogen™ Influenza A M1 Monoclonal Antibody (GA2B)

Glucagon Monoclonal Antibody (ICACLS), eFluor™ 570, eBioscience™, Invitrogen™

Invitrogen™ IFNAR2 Monoclonal Antibody (MMHAR-2)

Invitrogen™ CYP27B1 Polyclonal Antibody