All Primary Antibodies
Primary antibodies, immunoglobulins that bind to specific proteins or other biomolecules, are used in many research applications and protocols to detect targets of interest. They are developed using different animal hosts, including mouse, rat, rabbit, goat, sheep, and many others.
Monoclonal and Polyclonal Antibodies
One type of primary antibodies, monoclonal antibodies, provides high reproducibility and low cross-reactivity and background noise. Another type, polyclonal antibodies, often costs less and provides greater affinity and quicker binding. Both are produced using plasma B cells, but the former uses the same clone and the latter uses different clones. Monoclonal antibodies require hybridoma cell lines, and polyclonal antibodies do not.
There are also recombinant monoclonal antibodies with similar benefits, like high affinity, scalability, and specificity. They are produced using in vitro cloning of plasma B cells and expression hosts.
Conjugated Primary Antibodies
Antibodies can be labeled with various fluorophores or detection agents or used without labels. Labeled primary antibodies, also known as conjugated primary antibodies, help researchers simplify and streamline their applications. They are coupled with common enzymes and dyes such as Alexa Fluor and often used in protein and cell analysis.
Applications
Antibodies for life sciences applications are used in flow cytometry, western blotting, ELISA, immunohistochemistry, and immunocytochemistry. Secondary antibodies can be added to support the detection and purification of certain antigens. They bind to the primary antibody, which binds to the antigen of interest. Finding the right combination of antibodies can result in greater antigen specificity and a strong, detectable signal.
- (1)
- (7)
- (2)
- (3,051)
- (925)
- (1,939)
- (4,412)
- (1)
- (1)
- (3)
- (1)
- (1,258)
- (1,754)
- (921,450)
- (21,592)
- (2)
- (774)
- (61)
- (1)
- (29)
- (1)
- (5,588)
- (3,360)
- (1,862)
- (218)
- (1)
- (8,787)
- (12,059)
- (2,271)
- (9)
- (52)
- (1)
- (3)
- (4)
- (13)
- (2)
- (69)
- (5)
- (11)
- (12,287)
- (15,876)
- (10,955)
- (1)
- (1)
- (4)
- (1)
- (239)
- (78)
- (13)
- (2,669)
- (535)
- (1)
- (1)
- (136)
- (422)
- (3)
- (1)
- (3)
- (16)
- (110)
- (1)
- (189,996)
- (288,104)
- (1)
- (19)
- (798)
- (1)
- (12,214)
- (2)
- (129)
- (1)
- (2)
- (5)
- (11)
- (4)
- (9)
- (1)
- (2)
- (12)
- (34)
- (3)
- (1)
- (4)
- (1)
- (108)
- (1)
- (20)
- (19)
- (46)
- (1)
- (5)
- (1)
- (1)
- (10,751)
- (652)
- (1)
- (2)
- (1)
- (4)
- (6)
- (6)
- (1)
- (8)
- (3)
- (16)
- (2)
- (2)
- (329)
- (359)
- (5)
- (13,001)
- (2)
- (4,300)
- (2,250)
- (1)
- (14)
- (33)
- (1)
- (7)
- (1)
- (6,038)
- (3,903)
- (1)
- (20)
- (1)
- (1)
- (2)
- (40)
- (1)
- (2)
- (1)
- (17,537)
- (16,767)
- (18)
- (1)
- (1)
- (1)
- (5,545)
- (3)
- (2)
- (43)
- (4)
- (13)
- (1)
- (164)
- (748)
- (17)
- (2)
- (6)
- (1)
- (1)
- (2)
- (2,085)
- (1)
- (9)
- (3)
- (1)
- (1)
- (2)
- (6)
- (2)
- (2)
- (104)
- (1)
- (1)
- (3,865)
- (2)
- (20)
- (3)
- (112)
- (1)
- (1)
- (5)
- (2)
- (3)
- (33)
- (1)
- (5)
- (187)
- (2)
- (4,823)
- (12)
- (1)
- (2)
- (5)
- (9)
- (4)
- (7)
- (23)
- (130)
- (8,934)
- (39,658)
- (448)
- (53)
- (1,929)
- (1)
- (36)
- (7)
- (1)
- (2,681)
- (1)
- (4,478)
- (42)
- (2)
- (2)
- (1)
- (1)
- (4)
- (50)
- (1)
- (1)
- (815)
- (1)
- (1)
- (2)
- (2)
- (32)
- (40)
- (4)
- (6)
- (3)
- (6)
- (1)
- (3)
- (1)
- (3)
- (3)
- (31,161)
- (9)
- (1)
- (29)
- (2,893)
- (74)
- (89)
- (275)
- (2)
- (55)
- (29,965)
- (29,827)
- (6)
- (32,469)
- (16)
- (29,774)
- (45)
- (866)
- (48)
- (595)
- (30,794)
- (1)
- (32,527)
- (1)
- (3)
- (1)
- (73)
- (3)
- (30,317)
- (29,972)
- (3)
- (24,399)
- (24,961)
- (24,935)
- (24,831)
- (24,992)
- (24,794)
- (23)
- (127)
- (5)
- (103)
- (106)
- (2)
- (1)
- (92)
- (6)
- (15)
- (5)
- (34,906)
- (11)
- (3)
- (221)
- (761)
- (1,054)
- (721)
- (777)
- (920)
- (889)
- (1,009)
- (850)
- (1,470)
- (910)
- (835)
- (1,058)
- (1,059)
- (1,056)
- (681)
- (1,087)
- (30,490)
- (90)
- (9)
- (42)
- (17)
- (1)
- (103)
- (1)
- (139)
- (3)
- (79)
- (28,930)
- (28,983)
- (29,280)
- (63)
- (28,999)
- (25,597)
- (1)
- (60)
- (28,922)
- (28,575)
- (28,539)
- (17)
- (9)
- (1)
- (1)
- (7)
- (5)
- (33,652)
- (5)
- (30)
- (1)
- (1)
- (338)
- (734)
- (30,825)
- (1)
- (30,923)
- (27,238)
- (17,685)
- (17,678)
- (27,221)
- (30,927)
- (38)
- (1)
- (47)
- (9)
- (13)
- (2)
- (99)
- (11)
- (22)
- (58)
- (26)
- (127)
- (158)
- (25)
- (84)
- (58)
- (24)
- (56)
- (75)
- (9)
- (65)
- (73)
- (95)
- (84)
- (78)
- (28)
- (64)
- (70)
- (44)
- (58)
- (50)
- (53)
- (98)
- (122)
- (41)
- (58)
- (65)
- (77)
- (75)
- (454)
- (32,847)
- (7)
- (4)
- (311)
- (417)
- (2,778)
- (3,757)
- (24)
- (3)
- (37)
- (214)
- (2,662)
- (155)
- (41)
- (27,786)
- (558)
- (535)
- (6)
- (12)
- (13)
- (5)
- (6)
- (1,229)
- (858)
- (142)
- (536)
- (429)
- (878)
- (402)
- (325)
- (815)
- (756)
- (721)
- (2)
- (630)
- (722)
- (290)
- (752)
- (822)
- (634)
- (807)
- (12)
- (29)
- (116)
- (5)
- (274)
- (250)
- (125)
- (126)
- (95)
- (46)
- (11)
- (6)
- (5)
- (9)
- (3)
- (8)
- (2)
- (64)
- (14)
- (542,593)
- (7)
- (266)
- (49)
- (2)
- (367)
- (68)
- (47)
- (25)
- (271)
- (3)
- (3)
- (4)
- (29,993)
- (30,024)
- (29,977)
- (564)
- (2,894)
- (51)
- (1)
- (15)
- (1,780)
- (726)
- (3)
- (2)
- (6)
- (4)
- (5)
- (111,671)
- (68)
- (123)
- (2,111)
- (31,228)
- (221)
- (8)
- (23)
- (597,679)
- (16)
- (1)
- (800,229)
- (84,197)
- (3)
- (45,150)
- (174)
- (1)
- (1)
- (571)
- (2)
- (36)
- (23)
- (187)
- (1,232)
- (3)
- (4)
- (468)
- (98)
- (1)
- (1,429)
- (3)
- (2)
- (7)
- (2)
- (127)
- (2)
- (9)
- (95)
- (164)
- (51)
- (745)
- (1)
- (5)
- (8,432)
- (7,041)
- (12)
- (2)
- (1)
- (27)
- (27)
- (6)
- (161)
- (292)
- (1)
- (74)
- (2)
- (10,238)
- (43)
- (425)
- (171)
- (2,278)
- (156)
- (6)
- (348)
- (2)
- (1)
- (120)
- (1)
- (9)
- (10)
- (27)
- (84)
- (2)
- (23)
- (1)
- (677)
- (56)
- (8)
- (21)
- (109,131)
- (2)
- (2)
- (57)
- (70)
- (275)
- (18)
- (1,253)
- (6,085)
- (2)
- (7)
- (2)
- (2,152)
- (6)
- (57)
- (432,696)
- (31)
- (20,758)
- (15,649)
- (1,535)
- (377)
- (219)
- (79)
- (10,492)
- (4)
- (170)
- (28)
- (2)
- (28)
- (25)
- (1,047)
- (7)
- (2)
- (9)
- (18)
- (2)
- (1)
- (2)
- (92)
- (10)
- (2)
- (349,499)
- (2,675)
- (43,522)
- (93)
- (2)
- (50)
- (41)
- (1)
- (1)
- (4)
- (167)
- (2)
- (32,414)
- (127)
- (2)
- (1)
- (2)
- (150)
- (893)
- (15,271)
- (3)
- (2)
- (168)
- (30)
- (2)
- (2)
- (10)
- (819)
- (3)
- (2)
- (2)
- (2)
- (2)
- (10)
- (87)
- (64)
- (3)
- (337)
- (1,422)
- (2,837)
- (4)
- (290,181)
- (153,811)
- (191)
- (53)
- (197,229)
- (502,585)
- (77)
- (1,445)
- (43,005)
- (14)
- (267)
- (12,831)
- (529,528)
- (202)
- (609)
- (2)
- (3)
- (551)
- (6)
- (4)
- (211,657)
- (2,647)
- (27)
- (10)
- (51)
- (526)
- (25)
- (270)
- (1,156)
- (1,424)
- (7)
- (8)
- (1,339)
- (4)
- (2)
- (3)
- (26)
- (6,535)
- (1)
- (6)
- (814)
- (32)
- (9)
- (2)
- (434)
- (4)
- (4)
- (2)
- (22)
- (48)
- (1,208)
- (2)
- (16)
- (1,835)
- (1)
- (4)
- (2)
- (261)
- (437)
- (1,280)
- (39)
- (6)
- (43,436)
- (22)
- (1)
- (917)
- (85)
- (835)
- (1,910)
- (5)
- (2)
- (3)
- (2)
- (2)
- (22,381)
- (10)
- (1)
- (4)
- (1,390)
- (9)
- (2)
- (4)
- (135)
- (2)
- (1)
- (2,798)
- (105)
- (3)
- (13)
- (33)
- (1,513)
- (5)
- (2)
- (9,778)
- (4,867)
- (3,679)
- (1)
- (41)
- (11)
- (4,367)
- (2)
- (460)
- (442)
- (4)
- (26)
- (14)
- (52)
- (14)
- (2,642)
- (258)
- (3)
- (1)
- (1)
- (29)
- (13)
- (39)
- (2)
- (1)
- (2)
- (3)
- (1)
- (2)
- (1)
- (1,080,888)
- (3)
- (9,440)
- (19)
- (1)
- (51)
- (10)
- (74)
- (3)
- (3)
- (90)
- (40)
- (106)
- (494)
- (5)
- (728)
- (150)
- (62)
- (882)
- (8)
- (35)
- (8)
- (22)
- (5)
- (4)
- (2)
- (867)
- (2)
- (2,269)
- (51)
- (2)
- (5,100)
- (436)
- (1)
- (4)
- (24)
- (3)
- (4)
- (4)
- (8)
- (1)
- (2)
- (19,897)
- (1,027)
- (2,074)
- (426)
- (62)
- (1,190)
- (4)
- (9)
- (53)
- (9)
- (4)
- (47)
- (8)
- (29,697)
- (821)
- (2)
- (2)
- (4)
- (8)
- (5)
- (1,307)
- (9,923)
- (376)
- (1,447)
- (20)
- (855)
- (4)
- (2)
- (30)
- (2)
- (1)
- (1,022)
- (3)
- (9)
- (1)
- (18)
- (3)
- (2)
- (1,266)
- (3,505)
- (371)
- (2)
- (42)
- (5)
- (3)
- (4)
- (3)
- (6)
- (1,888)
- (12)
- (39)
- (4)
- (2,383)
- (164)
- (135)
- (50)
- (1,477)
- (263)
- (2)
- (14)
- (18)
- (1)
- (21)
- (4,674)
- (173)
- (44)
- (1)
- (2)
- (2)
- (5,218)
- (68)
- (578)
- (300)
- (3)
- (108)
- (1)
- (1,572)
- (43)
- (4)
- (2)
- (9)
- (497)
- (21)
- (352)
- (3)
- (3)
- (6)
- (149)
- (145)
- (1)
- (1,779)
- (126)
- (168)
- (42)
- (3)
- (2)
- (176)
- (1)
- (2)
- (36)
- (3,494)
- (218)
- (407)
- (1)
- (274)
- (240)
- (236)
- (160)
- (9)
- (15)
- (11)
- (5)
- (5,223)
- (308)
- (6)
- (10)
- (1)
- (4)
- (52)
- (23)
- (73)
- (2)
- (28)
- (709)
- (1,433,679)
- (695)
- (9)
- (19)
- (1)
- (5)
- (78)
- (519)
- (89)
- (57)
- (15)
- (80)
- (42)
- (441)
- (524)
- (3)
- (15)
- (4)
- (17)
- (107)
- (9)
- (17)
- (2)
- (24)
- (1)
- (24)
- (2)
- (2)
- (16)
- (59)
- (2)
- (18)
- (2)
- (496)
- (8)
- (1)
- (890)
- (1,201)
- (2)
- (8)
- (4)
- (59)
- (139)
- (4)
- (268)
- (1)
- (13)
- (23,997)
- (90)
- (8)
- (2)
- (3)
- (1)
- (571,362)
- (4,877)
- (1,533)
- (1)
- (254)
- (2)
- (3)
- (30)
- (28)
- (8)
- (798)
- (7,444)
- (5)
- (4)
- (46)
- (1,310)
- (23)
- (279)
- (113)
- (1)
- (143)
- (182)
- (1)
- (3)
- (13)
- (20)
- (62)
- (5)
- (6)
- (9)
- (17)
- (207)
- (18)
- (18,491)
- (545)
- (215)
- (25)
- (1,234)
- (6)
- (1)
- (3)
- (1)
- (3)
- (124)
- (11)
- (5)
- (14,722)
- (155)
- (401)
- (10)
- (4)
- (6)
- (62)
- (10,252)
- (532)
- (4)
- (10)
- (2)
- (338,673)
- (5,177)
- (2)
- (6)
- (399)
- (2)
- (33)
- (2,777)
- (1,119)
- (3)
- (10)
- (30)
- (65)
- (153)
- (57)
- (2)
- (247)
- (31)
- (36)
- (3)
- (951)
- (2)
- (5,182)
- (2)
- (1)
- (15)
- (2)
- (22)
- (1)
- (1)
- (2)
- (13)
- (1)
- (2)
- (1)
- (13)
- (3,894)
- (471)
- (1)
- (2)
- (19)
- (5)
- (6)
- (3)
- (9)
- (54)
- (8)
- (3)
- (1)
- (4)
- (87)
- (10)
- (2)
- (24)
- (2)
- (2)
- (42)
- (3)
- (2)
- (2)
- (23)
- (82)
- (2,574)
- (1)
- (8)
- (23)
- (2)
- (3)
- (1,402)
- (6)
- (22)
- (13)
- (4)
- (4)
- (202)
- (5)
- (1,337)
- (38)
- (6)
- (3)
- (19,930)
- (2)
- (50)
- (2)
- (5)
- (3)
- (148)
- (339)
- (183)
- (2,287)
- (1,820)
- (30)
- (16)
- (2)
- (2)
- (4,513)
- (5)
- (9)
Filtered Search Results
CD5 Monoclonal Antibody (53-7.3), Biotin, eBioscience™, Invitrogen™
Greener Choice
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Rat Monoclonal Antibody
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
| Content And Storage | 4°C, store in dark, DO NOT FREEZE! |
|---|---|
| Target Species | Mouse |
| Host Species | Rat |
| Conjugate | Biotin |
| Applications | Flow Cytometry |
| Form | Liquid |
| Isotype | IgG2a κ |
| Gene Accession No. | P13379 |
| Concentration | 0.5 mg/mL |
| Antigen | CD5 |
| Gene Symbols | Cd5 |
| Regulatory Status | RUO |
| Purification Method | Affinity chromatography |
| Gene | Cd5 |
| Product Type | Antibody |
| Gene ID (Entrez) | 12507 |
| Classification | Monoclonal |
| Primary or Secondary | Primary |
| Clone | 53-7.3 |
CD44 Monoclonal Antibody (IM7), PE-eFluor™ 610, eBioscience™, Invitrogen™
Greener Choice
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Rat Monoclonal Antibody
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
| Content And Storage | 4°C, store in dark, DO NOT FREEZE! |
|---|---|
| Target Species | Human,Mouse |
| Host Species | Rat |
| Conjugate | PE-eFluor 610 |
| Applications | Flow Cytometry |
| Form | Liquid |
| Isotype | IgG2b κ |
| Concentration | 0.2 mg/mL |
| Antigen | CD44 |
| Gene Symbols | CD44 |
| Regulatory Status | RUO |
| Purification Method | Affinity chromatography |
| Gene | CD44 |
| Product Type | Antibody |
| Gene ID (Entrez) | 12505, 960 |
| Classification | Monoclonal |
| Primary or Secondary | Primary |
| Clone | IM7 |
CD4 Monoclonal Antibody (GK1.5), PerCP-eFluor™ 710, eBioscience™, Invitrogen™
Greener Choice
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Rat Monoclonal Antibody
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
| Content And Storage | 4°C, store in dark, DO NOT FREEZE! |
|---|---|
| Target Species | Mouse |
| Host Species | Rat |
| Conjugate | PerCP-eFluor 710 |
| Applications | Flow Cytometry |
| Form | Liquid |
| Isotype | IgG2b κ |
| Gene Accession No. | P06332 |
| Concentration | 0.2 mg/mL |
| Antigen | CD4 |
| Gene Symbols | CD4 |
| Regulatory Status | RUO |
| Purification Method | Affinity chromatography |
| Gene Alias | Activation B7-1 antigen; B7; B7.1; B7-1; BB1; B-lymphocyte activation antigen B7; CD28LG; CD28LG1; CD4; CD4 antigen; CD4 antigen (p55); CD4 antigen p55; Cd4 molecule; CD4 precursor; CD4 receptor; CD4, allele 1; cd4a; CD4mut; CD80; CD80 antigen (CD28 antigen ligand 1, B7-1 antigen); CD80 molecule; cell surface glycoprotein CD4; costimulatory factor CD80; costimulatory molecule variant IgV-CD80; CTLA-4 counter-receptor B7.1; fCD4; L3T4; LAB7; Leu-3; Ly-4; lymphocyte antigen CD4; lymphocyte antigen CD4 precursor; membrane protein; p55; T-cell differentiation antigen L3T4; T-cell surface antigen T4/Leu-3; T-cell surface glycoprotein CD4; T-cell surface glycoprotein CD4 precursor (T-cell surface antigen T4/Leu-3) (T-cell differentiation antigen L3T4); T-lymphocyte activation antigen CD80; W3/25; W3/25 antigen |
| Gene | CD4 |
| Product Type | Antibody |
| Gene ID (Entrez) | 12504 |
| Formulation | PBS with 0.09% sodium azide; pH 7.2 |
| Classification | Monoclonal |
| Primary or Secondary | Primary |
| Clone | GK1.5 |
Invitrogen™ CD24 Monoclonal Antibody (eBioSN3 (SN3 A5-2H10)), eBioscience™
Greener Choice
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Mouse Monoclonal Antibody
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
| Content And Storage | 4°C |
|---|---|
| Target Species | Human |
| Host Species | Mouse |
| Conjugate | Unconjugated |
| Applications | Flow Cytometry |
| Form | Liquid |
| Gene Accession No. | P25063 |
| Isotype | IgG1 κ |
| Concentration | 0.5 mg/mL |
| Antigen | CD24 |
| Gene Symbols | Cd24 |
| Regulatory Status | RUO |
| Purification Method | Affinity chromatography |
| Gene Alias | CD24; CD24 antigen; CD24 antigen (small cell lung carcinoma cluster 4 antigen); CD24 molecule; CD24A; CD24a antigen; cluster of differentiation 24; FLJ22950; FLJ43543; heat stable antigen; heat-stable antigen; HSA; Ly-52; Lymphocyte antigen 52; M1/69-J11D heat stable antigen; MGC75043; Nectadrin; nectadrin heat stable antigen; R13-Ag; Signal transducer CD24; Small cell lung carcinoma cluster 4 antigen; X62 heat stable antigen |
| Gene | Cd24 |
| Product Type | Antibody |
| Gene ID (Entrez) | 100133941 |
| Formulation | PBS with 0.09% sodium azide; pH 7.2 |
| Classification | Monoclonal |
| Primary or Secondary | Primary |
| Clone | eBioSN3 (SN3 A5-2H10) |
Invitrogen™ CD20 Recombinant Mouse Monoclonal Antibody (18B12)
Greener Choice
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Mouse Recombinant Monoclonal Antibody
| Content And Storage | Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles. |
|---|---|
| Target Species | Mouse |
| Host Species | Mouse |
| Conjugate | Unconjugated |
| Applications | Flow Cytometry,Functional Assay,Western Blot,Immunocytochemistry |
| Form | Liquid |
| Gene Accession No. | P19437 |
| Isotype | IgG1 κ |
| Concentration | 1 mg/mL |
| Antigen | CD20 |
| Gene Symbols | Ms4a1 |
| Regulatory Status | RUO |
| Purification Method | Protein A |
| Gene Alias | AA960661; APY; ATOPY; B1; B-cell differentiation antigen Ly-44; B-lymphocyte antigen CD20; B-lymphocyte cell-surface antigen B1; B-lymphocyte surface antigen B1; Bp35; Cd20; CD20 antigen; CD20 cell surface protein; CD20 receptor; CVID5; EGK_06167; Fc epsilon receptor I beta chain; Fc Fragment of IgE high affinity I receptor for beta polypeptide; FCER1B; High affinity immunoglobulin epsilon receptor subunit beta; IgE Fc receptor subunit beta; IGEL; IGER; IGHER; LEU16; LEU-16; Leukocyte surface antigen Leu-16; Ly44; Ly-44; Lymphocyte antigen 44; membrane spanning 4-domains A1; membrane-spanning 4-domains subfamily A member 1; membrane-spanning 4-domains, subfamily A, member 1; membrane-spanning 4-domains, subfamily A, member 2; MGC3969; MS4A1; MS4A2; S7 |
| Gene | Ms4a1 |
| Product Type | Antibody |
| Gene ID (Entrez) | 12482 |
| Formulation | PBS with 0.02% ProClin 300 |
| Immunogen | This antibody was generated by immunizing CD20-/- mice with CD20-transfected cell lines (300.18 and 70Z3) and CD20-peptide-keyhole limpet hemocyanin conjugate. |
| Classification | Recombinant Monoclonal |
| Primary or Secondary | Primary |
| Clone | 18B12 |
Invitrogen™ PTH1R Polyclonal Antibody
Greener Choice
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Rabbit Polyclonal Antibody
| Content And Storage | -20°C, Avoid Freeze/Thaw Cycles |
|---|---|
| Target Species | Human |
| Host Species | Rabbit |
| Conjugate | Unconjugated |
| Applications | Immunohistochemistry (Paraffin),Western Blot,Immunocytochemistry |
| Form | Liquid |
| Gene Accession No. | Q03431 |
| Isotype | IgG |
| Concentration | Conc. Not Determined |
| Antigen | PTH1R |
| Gene Symbols | Pth1r |
| Regulatory Status | RUO |
| Gene Alias | MGC138426; MGC138452; Parathormone; Parathyrin; parathyroid hormone 1 receptor; parathyroid hormone receptor; parathyroid hormone receptor 1; parathyroid hormone/parathyroid hormone-related peptide receptor; parathyroid hormone/parathyroid hormone-related protein receptor; PFE; PPR; PTH; PTH/PTHr receptor; PTH/PTHrP receptor; PTH/PTHrP type I receptor; PTH1 receptor; PTH1R; Pthr; Pthr1; PTHrel; PTH-related peptide receptor; PTHrP-R; PTHrP-receptor; seven transmembrane helix receptor |
| Gene | Pth1r |
| Product Type | Antibody |
| Gene ID (Entrez) | 5745 |
| Formulation | whole serum with 0.02% sodium azide |
| Immunogen | Synthetic peptide corresponding to the C-terminal amino acids E(573)EASGPERPPALLQEEWETVM(593) of PTHR1. |
| Classification | Polyclonal |
| Primary or Secondary | Primary |
Invitrogen™ Growth Hormone Monoclonal Antibody (3E2)
Greener Choice
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Mouse Monoclonal Antibody
| Content And Storage | Maintain refrigerated at 2-8°C for up to 6 months. For long term storage store at -20°C |
|---|---|
| Target Species | Human |
| Host Species | Mouse |
| Conjugate | Unconjugated |
| Applications | ELISA,Immunoprecipitation,Radioimmune Assays (RIA) |
| Form | Liquid |
| Gene Accession No. | P01241 |
| Isotype | IgG1 |
| Concentration | 5.0 mg/mL |
| Antigen | Growth Hormone |
| Gene Symbols | Gh1 |
| Regulatory Status | RUO |
| Purification Method | Protein A |
| Gene Alias | dog growth hormone; GH; Gh1; GHB1; GHB5; GHN; GH-N; Growth hormone; growth hormone 1; growth hormone 12; growth hormone B1; growth hormone B5; growth hormone precursor; HGH; hGH-N; IGHD1B; pituitary growth hormone; rHGH; RNGHGP; Somatotropin |
| Gene | Gh1 |
| Product Type | Antibody |
| Gene ID (Entrez) | 2688 |
| Formulation | PBS with 0.1% sodium azide; pH 7.4 |
| Immunogen | Human Growth Hormone. |
| Classification | Monoclonal |
| Primary or Secondary | Primary |
| Clone | 3E2 |
Invitrogen™ RAGE Monoclonal Antibody (5C6C1)
Greener Choice
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Mouse Monoclonal Antibody
| Content And Storage | -20°C |
|---|---|
| Target Species | Human,Mouse,Rat |
| Host Species | Mouse |
| Conjugate | Unconjugated |
| Applications | Flow Cytometry,Immunohistochemistry (Paraffin),Western Blot |
| Form | Lyophilized |
| Gene Accession No. | Q15109, Q62151, Q63495 |
| Isotype | IgG2b |
| Concentration | 500 μg/mL |
| Antigen | RAGE |
| Gene Symbols | AGER |
| Regulatory Status | RUO |
| Purification Method | Antigen affinity chromatography |
| Gene Alias | advanced glycation end product receptor; advanced glycation end-product receptor; advanced glycation end-products receptor; advanced glycosylation end product-specific receptor; advanced glycosylation end product-specific receptor variant 2; advanced glycosylation end product-specific receptor variant 3; advanced glycosylation end product-specific receptor variant 4; advanced glycosylation end product-specific receptor variant 5; advanced glycosylation end-product specific receptor; Ager; MAPK/MAK/MRK overlapping kinase; MOK; MOK protein kinase; RAGE; RAGE isoform NtRAGE-delta; RAGE isoform sRAGE-delta; RAGE/AGER; RAGE1; RAGE-1; RAGE-4 ORF3; receptor for advanced glycation endproducts; receptor for advanced glycation end-products variant 20; receptor for advanced glycosylation end products; receptor of advanced glycosylation end products of proteins; immunoglobulin superfamily; MHC class II; MHC class III; renal cell carcinoma antigen; renal tumor antigen 1; SCARJ1; sRAGE; STK30 |
| Gene | AGER |
| Product Type | Antibody |
| Gene ID (Entrez) | 11596, 177, 81722 |
| Formulation | PBS with 4mg trehalose and no preservative |
| Immunogen | A synthetic peptide corresponding to a sequence at the N-terminus of human RAGE (91-120aa IQDEGIFRCQAMNRNGKETKSNYRVRVYQI). |
| Classification | Monoclonal |
| Primary or Secondary | Primary |
| Clone | 5C6C1 |
Invitrogen™ NFIA Monoclonal Antibody (16H11)
Greener Choice
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Mouse Monoclonal Antibody
| Content And Storage | -20°C |
|---|---|
| Target Species | Human |
| Host Species | Mouse |
| Conjugate | Unconjugated |
| Applications | Flow Cytometry,Immunocytochemistry,Immunohistochemistry (Paraffin),Western Blot |
| Form | Lyophilized |
| Gene Accession No. | Q12857 |
| Isotype | IgG2b |
| Concentration | 500 μg/mL |
| Antigen | NFIA |
| Gene Symbols | NFIA |
| Regulatory Status | RUO |
| Purification Method | Antigen affinity chromatography |
| Gene Alias | 1110047K16Rik; 9430022M17Rik; CCAAT-box-binding transcription factor; CTF; KIAA1439; NF1A; NF1-A; Nf1l21; NF-I/A; Nfia; NFI-A; NFI-L; Nuclear factor 1 A-type; nuclear factor 1/A; nuclear factor I A; nuclear factor I/A; TGGCA-binding protein; Unknown (protein for MGC:128467) |
| Gene | NFIA |
| Product Type | Antibody |
| Gene ID (Entrez) | 4774 |
| Formulation | PBS with 4mg trehalose and 0.05mg sodium azide |
| Immunogen | A synthetic peptide corresponding to a sequence in the middle region of human NFIA (180-224aa AYFVHAADSSQSESPSQPSDADIKDQPENGHLGFQDSFVTSGVFS). |
| Classification | Monoclonal |
| Primary or Secondary | Primary |
| Clone | 16H11 |
Invitrogen™ Phenytoin Monoclonal Antibody (1P1H2)
Greener Choice
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Mouse Monoclonal Antibody
| Content And Storage | Maintain refrigerated at 2-8°C for up to 6 months. For long term storage store at -20°C |
|---|---|
| Target Species | Chemical |
| Host Species | Mouse |
| Conjugate | Unconjugated |
| Applications | ELISA,Immunoprecipitation,Radioimmune Assays (RIA) |
| Form | Liquid |
| Isotype | IgG1 |
| Concentration | 5 mg/mL |
| Antigen | Phenytoin |
| Regulatory Status | RUO |
| Purification Method | Protein A |
| Gene Alias | Dilantin; Epanutin; Infatabs; Kapseals; Phenytek |
| Product Type | Antibody |
| Formulation | PBS with 0.09% sodium azide; pH 7.4 |
| Immunogen | Phenytoin-KLH. |
| Classification | Monoclonal |
| Primary or Secondary | Primary |
| Clone | 1P1H2 |
Invitrogen™ YAP1 Polyclonal Antibody
Greener Choice
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Rabbit Polyclonal Antibody
| Content And Storage | -20°C, Avoid Freeze/Thaw Cycles |
|---|---|
| Target Species | Canine,Human,Mouse,Rat,Zebrafish |
| Host Species | Rabbit |
| Conjugate | Unconjugated |
| Applications | ChIP Assay,Immunohistochemistry (Paraffin),Immunoprecipitation,Western Blot,Immunocytochemistry |
| Form | Liquid |
| Gene Accession No. | P46937, P46938, Q1L8J7, Q2EJA0 |
| Isotype | IgG |
| Concentration | 1.0 mg/mL |
| Antigen | YAP1 |
| Gene Symbols | YAP1 |
| Regulatory Status | RUO |
| Purification Method | Antigen affinity chromatography |
| Gene Alias | 65 kDa Yes-associated protein; AI325207; cb194; CH211-181P1.5-001; COB1; Protein yorkie homolog; sb:cb194; si:ch211-181p1.5; si:dkey-3b8.3; transcriptional coactivator YAP1; wu:fc18c04; yap; Yap1; YAP2; Yap65; Yes associated protein 1; Yes1 associated transcriptional regulator; yes-associated protein 1; yes-associated protein 2; yes-associated protein YAP65 homolog; yes-associated protein, 65 kDa; Yki; Yorkie; yorkie homolog; zgc:158380; zYAP |
| Gene | YAP1 |
| Product Type | Antibody |
| Gene ID (Entrez) | 10413, 22601, 363014, 479465, 561411 |
| Formulation | PBS with 0.02% sodium azide |
| Immunogen | Partial recombinant human YAP1 protein expressed in bacteria. |
| Classification | Polyclonal |
| Primary or Secondary | Primary |
Invitrogen™ TLR7 Polyclonal Antibody
Greener Choice
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Rabbit Polyclonal Antibody
| Content And Storage | Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles. |
|---|---|
| Target Species | Human,Mouse,Rat |
| Host Species | Rabbit |
| Conjugate | Unconjugated |
| Applications | Flow Cytometry,Immunohistochemistry (Frozen),Immunohistochemistry (Paraffin),Western Blot,Immunocytochemistry |
| Form | Liquid |
| Gene Accession No. | P58681, Q9NYK1 |
| Isotype | IgG |
| Concentration | 1.0 mg/mL |
| Antigen | TLR7 |
| Gene Symbols | TLR7 |
| Regulatory Status | RUO |
| Purification Method | Protein G |
| Gene Alias | RGD1563357; RP23-139P21.3; Tlr7; TLR7-like; toll like receptor 7; toll-like receptor 7; toll-like receptor 7-like; UNQ248/PRO285 |
| Gene | TLR7 |
| Product Type | Antibody |
| Gene ID (Entrez) | 170743, 317468, 51284 |
| Formulation | PBS with 0.05% sodium azide |
| Immunogen | KLH-conjugated synthetic peptide corresponding to amino acids 706-749 of human TLR7. |
| Classification | Polyclonal |
| Primary or Secondary | Primary |
Invitrogen™ Endothelin A Receptor Polyclonal Antibody
Greener Choice
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Rabbit Polyclonal Antibody
| Content And Storage | -20°C, Avoid Freeze/Thaw Cycles |
|---|---|
| Target Species | Human,Mouse,Rat |
| Host Species | Rabbit |
| Conjugate | Unconjugated |
| Applications | Immunohistochemistry (Frozen),Immunohistochemistry (Paraffin),Western Blot,Immunocytochemistry,Multiplex Immunohistochemistry |
| Form | Liquid |
| Gene Accession No. | P25101, P26684, Q61614 |
| Isotype | IgG |
| Concentration | Conc. Not Determined |
| Antigen | Endothelin A Receptor |
| Gene Symbols | EDNRA |
| Regulatory Status | RUO |
| Gene Alias | Ednra; Endor; Endothelin A; endothelin A receptor; endothelin receptor subtype A; endothelin receptor type A; endothelin type A receptor; endothelin-1 receptor; endothelin-1-specific receptor; ETa; ET-A; ETAR; ET-AR; ETA-R; ETRA; G protein coupled receptor; G protein-coupled receptor; Gpcr10; G-protein coupled receptor 10; hET-AR; MFDA; RGD1559432 |
| Gene | EDNRA |
| Product Type | Antibody |
| Gene ID (Entrez) | 13617, 1909, 24326 |
| Formulation | Whole serum with 0.02% sodium azide |
| Immunogen | COOH-terminal amino acids of mouse ETA (408-427) KNQEQNNHNTERSSHKDSMN coupled to KLH. |
| Classification | Polyclonal |
| Primary or Secondary | Primary |
Invitrogen™ EGFR Recombinant Rabbit Monoclonal Antibody (30H45L48), Alexa Fluor™ 488
Greener Choice
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Rabbit Recombinant Monoclonal Antibody
| Content And Storage | 4°C, store in dark, DO NOT FREEZE! |
|---|---|
| Target Species | Human |
| Host Species | Rabbit |
| Conjugate | Alexa Fluor 488 |
| Applications | Immunocytochemistry |
| Form | Liquid |
| Gene Accession No. | P00533 |
| Isotype | IgG |
| Concentration | 1 mg/mL |
| Antigen | EGFR |
| Gene Symbols | EGFR |
| Regulatory Status | RUO |
| Purification Method | Protein A |
| Gene Alias | 2.7.10.1; 9030024J15Rik; AI552599; avian erythroblastic leukemia viral (v-erbB) oncogene homolog; avian erythroblastic leukemia viral (v-erb-b) oncogene homolog; cell growth inhibiting protein 40; cell proliferation-inducing protein 61; EC 2.7.10.1; egf receptor; Egfr; EGFR-related peptide; epidermal growth factor receptor; epidermal growth factor receptor (erythroblastic leukemia viral (v-erb-b) oncogene homolog, avian); Epidermal growth factor receptor formerly avian erythroblastic leukemia viral (v-erbB) oncogene homolog (Erbb1); epidermal growth factor receptor, formerly avian erythroblastic leukemia viral (v-erbB) oncogene homolog (Erbb1); ERBB; ERBB1; ErbB-1; erb-b2 receptor tyrosine kinase 1; Errb1; Errp; HER1; kinase EGFR; mENA; NISBD2; Oncogene ERBB; PIG61; Proto-oncogene c-ErbB-1; receptor tyrosine-protein kinase erbB-1; Urogastrone; wa2; wa-2; Wa5; waved 2 |
| Gene | EGFR |
| Product Type | Antibody |
| Gene ID (Entrez) | 1956 |
| Formulation | PBS with 1mg/mL BSA and 0.05% sodium azide; pH 7.4 |
| Immunogen | Proprietary. |
| Classification | Recombinant Monoclonal |
| Primary or Secondary | Primary |
| Clone | 30H45L48 |
Invitrogen™ CD45.2 Monoclonal Antibody (104), Alexa Fluor™ 647
Greener Choice
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Mouse Monoclonal Antibody
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
| Content And Storage | 4°C, store in dark |
|---|---|
| Target Species | Mouse |
| Host Species | Mouse |
| Conjugate | Alexa Fluor 647 |
| Applications | Flow Cytometry |
| Form | Liquid |
| Gene Accession No. | P06800 |
| Isotype | IgG2a κ |
| Concentration | 0.5 mg/mL |
| Antigen | CD45.2 |
| Gene Symbols | Ptprc |
| Regulatory Status | RUO |
| Purification Method | Purified |
| Gene Alias | B220; Cd45; CD45 antigen; CD45R; GP180; LCA; L-CA; leukocyte common antigen; loc; LY5; Ly-5; lymphocyte antigen 5; lymphocyte common antigen; Lyt-4; protein tyrosine phosphatase, receptor type, C; Ptprc; Receptor-type tyrosine-protein phosphatase C; T200; T200 glycoprotein |
| Gene | Ptprc |
| Product Type | Antibody |
| Gene ID (Entrez) | 19264 |
| Formulation | PBS with <0.1% sodium azide; pH 7.4 |
| Immunogen | B10.S mouse thymocytes and splenocytes. |
| Classification | Monoclonal |
| Primary or Secondary | Primary |
| Clone | 104 |