Protein Labeling Reagents
Medchemexpress LLC HY-D0251 1g Medchemexpress, Fluorescein CAS:2321-07-5 Purity:>98%
Medchemexpress, HY-D0251 1g Fluorescein CAS:2321-07-5 Fluorescein is a synthetic fluorescent tracer. Purity:>98% Medchemexpress has over 10000 novel life-science reagents, reference compounds, APIs and natural compounds for laboratory and scientific use. Other quantity can also be offered.
STA Pharmaceutical Fmoc-L-Lys(5-FAM)-OH | 50 g | CAS 1242933-88-5 | MDL MFCD03787910
Fmoc-L-Lys(5-FAM)-OH is a Amino Acid reagent (Subcategory: Lys) sold by WuXi TIDES. Offered in 50 g. Store at 4 °C. SDS available for reference.
Specifications
- CAS: 1242933-88-5
- MDL: MFCD03787910
- InChIKey: ZAGGWQSWIFPNCB-DHUJRADRSA-N
- Molecular Weight: 726.738
- Molecular Formula: C42H34N2O10
- Purity: ≥95%
- Container Type: 250 mL HDPE
- Pack Size: 50 g
- Net Weight: 50 g
- Gross Weight: 89.8 g
- Commodity Code: 29322090
- Country Of Origin: China
- IUPAC: N2-(((9H-fluoren-9-yl)methoxy)carbonyl)-N6-(3',6'-dihydroxy-3-oxo-3H-spiro[isobenzofuran-1,9'-xanthene]-5-carbonyl)-L-lysine
- SMILES: O=C(OCC1C2=C(C3=C1C=CC=C3)C=CC=C2)N[C@@H](CCCCNC(C4=CC5=C(C=C4)C6(C7=C(OC8=C6C=CC(O)=C8)C=C(O)C=C7)OC5=O)=O)C(O)=O
CPC Scientific TAMRA-Ser-Pro-Lys-Met-Val-Gln-Gly-Ser-Gly-Cys-Phe-Gly-Arg-Lys-Met-Asp-Arg-Ile-Ser-Ser-Ser-Ser-Gly-Leu-Gly-Cys-Lys-Val-Leu-Arg-Arg-His-OH (trifluoroacetate salt) 0.5MG
Brain natriuretic peptide or B-type natriuretic peptide (BNP) (also ventricular natriuretic peptide) is a 32-amino acid peptide secreted by heart ventricles in response to excessive stretching of heart muscle cells (cardiomyocytes).ONE-LETTER SEQUENCE: TAMRA-SPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH (Cys10 and 26 bridge)MOLECULAR FORMULA: C168H266N52O46S4MOLECULAR WEIGHT:3878.6STORAGE CONDITIONS: -20 5C, CAS REGISTRY NUMBER: [114471-18-0], RESEARCH AREA: CardiovascularREFERENCES: T. Sudoh et al., BBRC, 159, 1427 (1989)
Apexbio Technology LLC Cy5 NHS ester(Et),5mg
Other sizes are also available. Please inqury us for quote.
Medchemexpress LLC Sulfo-cyanine5-alkyne | 1345823-20-2 | 95.3% | 693.87 g·mol⁻¹ | C36H43N3O7S2 | 10 MG
CY5-YNE (sulfo-Cyanine5-alkyne) is a clickable fluorescent labeling reagent containing an alkyne for copper-catalyzed azide-alkyne cycloaddition (CuAAC). It is used to covalently label peptides, proteins, and oligonucleotides for fluorescence detection and imaging.
- Alkyne functional group enables click chemistry conjugation.
- Excitation 645 nm, emission 670 nm for Cy5-compatible detection.
- Molecular weight 693.87 g·mol⁻¹ and formula C36H43N3O7S2.
- Provided as solid or 10 mM solution in DMSO for flexible use.
- Reported purity ≈95.3%; store protected from light.
Medchemexpress LLC HY-D0893 5mg Medchemexpress, NSP-SA-NHS CAS:199293-83-9 Purity:>98%
Medchemexpress, HY-D0893 5mg NSP-SA-NHS CAS:199293-83-9 NSP-SA-NHS is a chemiluminescent acridinium ester. Purity:>98% Medchemexpress has over 10000 novel life-science reagents, reference compounds, APIs and natural compounds for laboratory and scientific use. Other quantity can also be offered.
Apexbio Technology LLC Cyclo (-RGDfK), 5mg. Cas: 161552-03-0 MFCD: MFCD00937400. Inhibitor of αvβ3 integrin
In one study where this peptide was labeled with 125I, it was found to bind specifically and with high affinity to v3 receptors on neovascular blood vessel sections of different major human cancers. The integrin alpha(IIb)beta(3)-specific cyclic hexapeptide contains an Arg-Gly-Asp (RGD) sequence. Other sizes are available. Please inqury us for quote.
Medchemexpress LLC Cyanine5 NHS ester (iodide) | 00-00-0 | 98.0% | C36H42IN3O4 | 10MG
Cyanine5 NHS ester iodide is an amine-reactive, red-emitting fluorescent dye for covalent labeling of primary amino groups in peptides, proteins, and oligonucleotides. Supplied as a solid NHS-ester with an iodide counter-ion, it is characterized for research use with COA, SDS, HNMR, and LCMS documentation to support conjugation and analytical workflows.
- Red emission suitable for near-infrared fluorescence detection.
- Amine-reactive NHS ester for covalent labeling of primary amines.
- High purity supporting consistent conjugation performance.
- Available in multiple small-scale pack sizes for research use.
- Characterized by COA, HNMR, and LCMS documentation.
CPC Scientific TAMRA-Asp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-OH (trifluoroacetate salt) 0.1MG
Synthetic peptide that forms fibrils with have the same antigenic and structural features as those of native AD amyloid filaments.ONE-LETTER SEQUENCE: TAMRA-DAEFRHDSGYEVHHQKLVFFAEDVGSNKMOLECULAR FORMULA: C170H230N43O50MOLECULAR WEIGHT:3676STORAGE CONDITIONS: -20 5C, CAS REGISTRY NUMBER: [109770-29-8], RESEARCH AREA: Alzheimer's DiseaseREFERENCES: J. Kang et al., Nature, 325, 773 (1987)
Apexbio Technology LLC Cy3.5 NHS ester (non-sulfonated), 5mg. Cas: MFCD: NA. Labeling of amino-groups in biomolecules.
Cyanine3.5 NHS ester is a dye for labeling of oligonucleotides, peptides and proteins which contain amino-groups. For fluorescence imaging and other fluorescence-based biochemical analysis, it has been used to label biological molecules too. Other sizes are available. Please inqury us for quote.
Medchemexpress LLC Cy5-PEG3-azide | 00-00-0 | C40H55ClN6O4 | 10MG
Cy5-PEG3-azide is a Cy5-labeled PEG3 azide reagent for click-chemistry labeling and linker applications. It enables copper-catalyzed azide-alkyne cycloaddition (CuAAC) and strain-promoted alkyne-azide cycloaddition (SPAAC) to attach Cy5 fluorescence to alkyne-bearing molecules for bioconjugation, imaging, and PROTAC synthesis.
- Provides Cy5 fluorescence for detection and imaging.
- Contains a PEG3 spacer to improve solubility and reduce steric hindrance.
- Reactive azide functional group for CuAAC and SPAAC conjugations.
- Supplied as a dry powder for convenient storage and handling.
- Store protected from light at -20°C; in solvent, store at -80°C for long-term.
STA Pharmaceutical Fmoc-L-Lys(5-FAM)-OH | 1 g | CAS 1242933-88-5 | MDL MFCD03787910
Fmoc-L-Lys(5-FAM)-OH is a Amino Acid reagent (Subcategory: Lys) sold by WuXi TIDES. Offered in 1 g. Store at 4 °C. SDS available for reference.
Specifications
- CAS: 1242933-88-5
- MDL: MFCD03787910
- InChIKey: ZAGGWQSWIFPNCB-DHUJRADRSA-N
- Molecular Weight: 726.738
- Molecular Formula: C42H34N2O10
- Purity: ≥95%
- Container Type: 15 mL HDPE
- Pack Size: 1 g
- Net Weight: 1 g
- Gross Weight: 7.8 g
- Commodity Code: 29322090
- Country Of Origin: China
- IUPAC: N2-(((9H-fluoren-9-yl)methoxy)carbonyl)-N6-(3',6'-dihydroxy-3-oxo-3H-spiro[isobenzofuran-1,9'-xanthene]-5-carbonyl)-L-lysine
- SMILES: O=C(OCC1C2=C(C3=C1C=CC=C3)C=CC=C2)N[C@@H](CCCCNC(C4=CC5=C(C=C4)C6(C7=C(OC8=C6C=CC(O)=C8)C=C(O)C=C7)OC5=O)=O)C(O)=O
CPC Scientific TAMRA-Ser-Pro-Lys-Met-Val-Gln-Gly-Ser-Gly-Cys-Phe-Gly-Arg-Lys-Met-Asp-Arg-Ile-Ser-Ser-Ser-Ser-Gly-Leu-Gly-Cys-Lys-Val-Leu-Arg-Arg-His-OH (trifluoroacetate salt) 1MG
Brain natriuretic peptide or B-type natriuretic peptide (BNP) (also ventricular natriuretic peptide) is a 32-amino acid peptide secreted by heart ventricles in response to excessive stretching of heart muscle cells (cardiomyocytes).ONE-LETTER SEQUENCE: TAMRA-SPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH (Cys10 and 26 bridge)MOLECULAR FORMULA: C168H266N52O46S4MOLECULAR WEIGHT:3878.6STORAGE CONDITIONS: -20 5C, CAS REGISTRY NUMBER: [114471-18-0], RESEARCH AREA: CardiovascularREFERENCES: T. Sudoh et al., BBRC, 159, 1427 (1989)