Mass Spectrometers

Mass spectrometry is a technique that measures the mass-to-charge ratio of ions; used to quantify known materials, to identify unknown compounds within a sample, and to elucidate the structure and chemical properties of a variety of chemical species.

1 – 15 of 832 results

Scientific Cell Company Glass Filters for Testing Photometric Accuracy

For testing the photometric accuracy.

Pricing & Availability
Specifications

Includes	DAkkS calibration certificate
Type	Glass Filter

Scientific Cell Company Liquid Filter for Testing Photmetric Accuracy

For testing photometric accuracy (1.25 Abs) in the UV range.

Pricing & Availability

Scientific Cell Company Liquid Filter Set For Testing Stray Light

Certified set for testing stray light.

Pricing & Availability
Specifications

Includes	UV10, UV12, DAkkS
Type	Liquid Filter Set
For Use With (Application)	Testing stray light

Scientific Cell Company Liquid Filter Set for Testing Photometric Accuracy in UV Range

For testing photometric accuracy (0.75 Abs) in the UV range, according to European Pharmacopoeia.

Pricing & Availability

Invitrogen™ Human PKC delta (aa 8-150) Control Fragment Recombinant Protein

Recombinant Protein

Pricing & Availability
Specifications

Regulatory Status	RUO
Purity or Quality Grade	>80% by SDS-PAGE and Coomassie blue staining
Conjugate	Unconjugated
Form	Liquid
Formulation	1 M urea, PBS with no preservative; pH 7.4
Sequence	AFNSYELGSLQAEDEANQPFCAVKMKEALSTERGKTLVQKKPTMYPEWKSTFDAHIYEGRVIQIVLMRAAEEPVSEVTVGVSVLAERCKKNNGKAEFWLDLQPQAKVLMSVQYFLEDVDCKQSMRSEDEAKFPTMNRRGAIKQ
Concentration	≥5.0 mg/mL
For Use With (Application)	Blocking Assay,Control
Name	Human PKC delta (aa 8-150) Control Fragment
Recombinant	Recombinant