Antibiotics
- (3)
- (1)
- (1)
- (165)
- (26)
- (31)
- (6)
- (18)
- (1)
- (1)
- (36)
- (1)
- (8)
- (5)
- (28)
- (1)
- (2)
- (1)
- (1)
- (4)
- (1)
- (72)
- (10)
- (3)
- (44)
- (2)
- (1)
- (1)
- (2)
- (3)
- (4)
- (6)
- (1)
- (2)
- (138)
- (7)
- (13)
- (4)
- (23)
- (5)
- (1)
- (27)
- (174)
- (6)
- (1)
- (23)
- (22)
- (1)
- (9)
- (1)
- (23)
- (1)
- (19)
- (1)
- (29)
- (1)
- (1)
- (24)
- (1)
- (2)
- (1)
- (144)
- (1)
- (2)
- (1)
- (5)
- (1)
- (2)
- (2)
- (13)
- (3)
- (1)
- (4)
- (5)
- (1)
- (4)
- (2)
- (17)
- (1)
- (4)
- (7)
- (1)
- (3)
- (2)
- (4)
- (1)
- (2)
- (5)
- (1)
- (2)
- (5)
- (6)
- (2)
- (3)
- (1)
- (2)
- (1)
- (9)
- (3)
- (2)
- (2)
- (3)
- (3)
- (12)
- (2)
- (2)
- (2)
- (7)
- (3)
- (2)
- (2)
- (1)
- (2)
- (4)
- (6)
- (2)
- (2)
- (1)
- (1)
- (2)
- (1)
- (1)
- (1)
- (3)
- (5)
- (2)
- (1)
- (2)
- (2)
- (2)
- (1)
- (4)
- (2)
- (2)
- (5)
- (4)
- (2)
- (2)
- (1)
- (5)
- (7)
- (3)
- (2)
- (3)
- (1)
- (2)
- (2)
- (2)
- (3)
- (3)
- (2)
- (2)
- (3)
- (2)
- (1)
- (3)
- (2)
- (2)
- (3)
- (2)
- (1)
- (2)
- (4)
- (4)
- (2)
- (1)
- (3)
- (2)
- (1)
- (5)
- (9)
- (2)
- (1)
- (3)
- (4)
- (7)
- (1)
- (1)
- (2)
- (1)
- (1)
- (2)
- (3)
- (2)
- (1)
- (2)
- (7)
- (6)
- (3)
- (3)
- (2)
- (16)
- (1)
- (2)
- (2)
- (2)
- (2)
- (11)
- (1)
- (4)
- (3)
- (3)
- (2)
- (1)
- (4)
- (1)
- (11)
- (7)
- (2)
- (3)
- (1)
- (1)
- (2)
- (7)
- (2)
- (1)
- (1)
- (3)
- (2)
- (2)
- (4)
- (1)
- (1)
- (2)
- (3)
- (2)
- (2)
- (2)
- (3)
- (2)
- (1)
- (2)
- (2)
- (5)
- (1)
- (3)
- (4)
- (5)
- (6)
- (5)
- (4)
- (2)
- (1)
- (2)
- (5)
- (2)
- (4)
- (9)
- (9)
- (7)
- (4)
- (3)
- (1)
- (1)
- (2)
- (2)
- (1)
- (2)
- (2)
- (8)
- (1)
- (8)
- (2)
- (14)
- (3)
- (8)
- (1)
- (14)
- (2)
- (2)
- (3)
- (2)
- (4)
- (7)
- (3)
- (2)
- (3)
- (2)
- (3)
- (2)
- (17)
- (4)
- (1)
- (3)
- (2)
- (6)
- (2)
- (1)
- (1)
- (3)
- (6)
- (3)
- (2)
- (1)
- (1)
- (8)
- (4)
- (3)
- (6)
- (3)
- (5)
- (6)
- (1)
- (7)
- (9)
- (2)
- (1)
- (1)
- (11)
- (186)
- (10)
- (9)
- (4)
- (7)
- (112)
- (10)
- (1)
- (1)
- (507)
- (2)
- (17)
- (52)
- (3)
- (1)
- (3)
- (3)
- (3)
- (7)
- (1)
- (1)
- (9)
- (4)
- (3)
- (13)
- (5)
- (2)
- (17)
- (8)
- (2)
- (4)
- (1)
- (1)
- (1)
- (4)
- (1)
- (1)
- (2)
- (6)
- (5)
- (2)
- (8)
- (2)
- (1)
- (1)
- (3)
- (2)
- (2)
- (2)
- (1)
- (2)
- (2)
- (3)
- (2)
- (2)
- (2)
- (2)
- (7)
- (4)
- (1)
- (3)
- (6)
- (5)
- (1)
- (6)
- (2)
- (2)
- (3)
- (2)
- (3)
- (1)
- (1)
- (4)
- (5)
- (3)
- (8)
- (1)
- (2)
- (1)
- (5)
- (3)
- (2)
- (2)
- (1)
- (10)
- (2)
- (2)
- (7)
- (1)
- (2)
- (4)
- (7)
- (2)
- (5)
- (5)
- (2)
- (2)
- (2)
- (1)
- (5)
- (3)
- (2)
- (3)
- (3)
- (1)
- (1)
- (5)
- (4)
- (4)
- (1)
- (3)
- (4)
- (3)
- (2)
- (5)
- (1)
- (3)
- (2)
- (4)
- (3)
- (2)
- (4)
- (2)
- (2)
- (13)
- (3)
- (2)
- (1)
- (1)
- (2)
- (5)
- (3)
- (7)
- (6)
- (2)
- (4)
- (1)
- (2)
- (3)
- (9)
- (2)
- (7)
- (2)
- (2)
- (1)
- (5)
- (9)
- (1)
- (2)
- (4)
- (7)
- (4)
- (7)
- (5)
- (10)
- (2)
- (2)
- (3)
- (10)
- (1)
- (2)
- (4)
- (1)
- (2)
- (3)
- (1)
- (2)
- (5)
- (1)
- (3)
- (11)
- (1)
- (3)
- (2)
- (10)
- (5)
- (1)
- (13)
- (1)
- (2)
- (2)
- (1)
- (1)
- (4)
- (1)
- (3)
- (1)
- (2)
- (3)
- (2)
- (8)
- (2)
- (1)
- (2)
- (1)
- (20)
- (1)
- (4)
- (2)
- (1)
- (4)
- (1)
- (2)
- (2)
- (2)
- (3)
- (9)
- (2)
- (5)
- (3)
- (4)
- (1)
- (13)
- (11)
- (1)
- (3)
- (12)
- (7)
- (2)
- (2)
- (14)
- (3)
- (3)
- (3)
- (3)
- (4)
- (1)
- (5)
- (2)
- (1)
- (16)
- (1)
- (2)
- (2)
- (1)
- (2)
- (7)
- (1)
- (2)
- (17)
- (7)
- (2)
- (8)
- (2)
- (3)
- (3)
- (2)
- (10)
- (5)
- (8)
- (5)
- (3)
- (1)
- (7)
- (2)
- (4)
- (2)
- (12)
- (2)
- (8)
- (5)
- (3)
- (9)
- (3)
- (6)
- (1)
- (4)
- (3)
- (399)
- (15)
- (2)
- (34)
- (19)
- (54)
- (28)
- (76)
Filtered Search Results
Chem-Impex International, Inc. Cefoperazone sodium salt | 62893-20-3 | MFCD07793331 | 1G
Cefoperazone sodium salt, 62893-20-3, MFCD07793331, 1G
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Research Products International Corp Streptomycin Sulfate 250 G
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Streptomycin Sulfate is an aminoglycoside antibiotic that inhibits bacterial protein synthesis by binding to the 30S ribosomal subunit, disrupting the initiation complex and leading to misreading of mRNA. This interference prevents proper translation and inhibits bacterial growth. Streptomycin is employed in microbiology for selective bacterial isolation and antibiotic sensitivity testing to assess the susceptibility of bacterial strains. Ideal for studying bacterial susceptibility patterns and antibiotic resistance. Its inclusion in culture media aids in selectively isolating bacteria susceptible to this antibiotic.
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Sigma Aldrich Fine Chemicals Biosciences Imipenem monohydrate United States Pharmacopeia (USP) Reference Standard | 74431-23-5 | MFCD09753321 | 100MG
Imipenem monohydrate United States Pharmacopeia (USP) Reference Standard | Mol Wt: 317.36 | 74431-23-5 | MFCD09753321 | 100MG
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Medchemexpress LLC Mi-389 | 2222635-92-7 | 99.3% | C35H35FN6O6 | 10MG
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
MI-389 is a PROTAC small-molecule degrader that recruits cereblon to induce proteasomal degradation of the translation termination factor GSPT1. The compound is provided for research use with defined molecular formula, characterized purity, solubility data, and storage recommendations to support reproducible in vitro and cellular studies.
- High purity (99.3%).
- Targets cereblon and GSPT1.
- Soluble in DMSO; use newly opened DMSO due to hygroscopic effects.
- Stable under recommended storage: 4°C as solid; in solution -80°C up to 6 months, -20°C up to 1 month.
- Intended for PROTAC-focused cellular and biochemical research applications.
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
CPC Scientific H-Ala-Val-Ser-Glu-His-Gln-Leu-Leu-His-Asp-Lys-Gly-Lys-Ser-Ile-Gln-Asp-Leu-Arg-Arg-Arg-Phe-Phe-Leu-His-His-Leu-Ile-Ala-Glu-Ile-His-Thr-Ala-Glu-Ile-Arg-Ala-Thr-Ser-OH (trifluoroacetate salt) 1MG
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
A parathyroid hormone (PTH)-related peptide (1-40), human.ONE-LETTER SEQUENCE: AVSEHQLLHDKGKSIQDLRRRFFLHHLIAEIHTAEIRATSMOLECULAR FORMULA: C207H334N66O58MOLECULAR WEIGHT:4675.34STORAGE CONDITIONS: -20 5C, CAS REGISTRY NUMBER: [120298-73-9], SYNONYMS: pTH-Related Protein (1-40) (human, mouse, rat)RESEARCH AREA: Osteoporosis
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Sigma Aldrich Fine Chemicals Biosciences Ionomycin from Streptomyces conglobatus >=98% (HPLC) | 56092-81-0 | MFCD06798385 | 5MG
Ionomycin from Streptomyces conglobatus >=98% (HPLC) | Purity: >=98% (HPLC) | Mol Wt: 709 | 56092-81-0 | MFCD06798385 | 5MG
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
eMolecules Medchem Express / Ethylmalonic acid-d3 / 1mg / 784544273 / HY-34740S / / 70907-93-6 / [null] / 135.133 / C5H8O4
Medchem Express / Ethylmalonic acid-d3 / 1mg / 784544273 / HY-34740S / / 70907-93-6 / [null] / 135.133 / C5H8O4
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Med Vet International Penicillin VK Tablets 500mg 100ct
VET LICENSE NEEDS TO BE PROVIDED IN 3-4 BUSINESS DAYS OR ORDER WILL BE CANCELLED
Penicillin VK Tablets 500mg 100ct
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
TOKU-E Tetracycline ReadyMade™ Solution | Tetracycline HCl | 64-75-5 | 10 mg/ML in water | filter-sterile | 10 x 1 ML
Tetracycline ReadyMade™ Solution | Tetracycline HCl | 64-75-5 | 10 mg/ML in water | filter-sterile | 10 x 1 ML
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Invivogen G418 5 G (100 MG/ML)
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
G418, also known as G418 sulfate and Geneticin, is an aminoglycoside antibiotic similar in structure to gentamicin B1, produced by Micromonospora rhodorangea. G418 blocks polypeptide synthesis by inhibiting the elongation step in both prokaryotic and eukaryotic cells. Resistance to G418 is conferred by the Neomycin resistance gene (neo) from Tn5 encoding an aminoglycoside 3‘-phosphotransferase, APH 3‘ II. Selection in mammalian cells is usually achieved in three to seven days with concentrations ranging from 400 to 1000 µg/ml. Cells that are dividing are affected sooner than those that are not.
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Chem-Impex International, Inc. Tobramycin | 32986-56-4 | MFCD00077885 | 100MG
Tobramycin, 32986-56-4, MFCD00077885, 100MG
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
TOKU-E Trimethoprim ReadyMade™ Solution | 25 mg/ML in DMSO | filter-sterile | 1 ML
Trimethoprim ReadyMade™ Solution | 25 mg/ML in DMSO | filter-sterile | 1 ML
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
TOKU-E NOVOBIOCIN SOLN 10X1ML
Antibiotic,ReadyMade™, sterile-filtered, 100 mg/ml in water. Useful in cancer research, cell culture, susceptibility testing.
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
TOKU-E NYSTATIN SOLN 1ML
Antibiotic, ReadyMade™, sterile solution, 20,000-40,000 IU/ml in 0.02N HCl. Useful anti-mycotic used to control contamination in cell culture, plant biology and in susceptibility testing.
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Chem-Impex International, Inc. Vancomycin hydrochloride | 1404-93-9 | MFCD03613611 | 5G
Vancomycin hydrochloride, 1404-93-9, MFCD03613611, 5G
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More