Primary Antibodies

Primary antibodies are immunoglobulins that recognize and bind to a specific antigen of interest with high affinity and specificity to purify, detect, and measure that antigen. Includes antibody pairs for specific biochemical applications.

Search Within Results

2,446 – 2,460 of 1,660,841 results

2,446

Invitrogen™ SLC34A2 Polyclonal Antibody

Rabbit Polyclonal Antibody

Pricing & Availability
Specifications

Content And Storage	-20°C
Target Species	Human,Mouse,Rat
Host Species	Rabbit
Conjugate	Unconjugated
Applications	Immunohistochemistry (Paraffin),Western Blot,Immunohistochemistry (Paraffin),Western Blot
Form	Lyophilized
Gene Accession No.	O95436, Q9DBP0, Q9JJ09
Isotype	IgG
Concentration	500 μg/mL
Antigen	SLC34A2
Gene Symbols	SLC34A2
Regulatory Status	RUO
Purification Method	Antigen affinity chromatography
Gene Alias	AA536683; D5Ertd227e; Na(+)/Pi cotransporter 2B; Na(+)-dependent phosphate cotransporter 2B; NAPI IIb; NaPi-2b; NaPi3b; NAPI-3B; NAPI-IIb; Npt2b; NPTIIb; rNaPi IIb; Slc34a2; Sodium/phosphate cotransporter 2B; Sodium-dependent phosphate transport protein 2B; sodium-phosphate transport protein 2B; solute carrier family 34 (sodium phosphate), member 2; solute carrier family 34 (type II sodium/phosphate contransporter), member 2; solute carrier family 34 (type II sodium/phosphate cotransporter), member 2; solute carrier family 34 member 2; type II sodium-dependent phosphate transporter 3b; type IIb Na/Picotransporter; type IIb sodium-phosphate transporter
Gene	SLC34A2
Product Type	Antibody
Gene ID (Entrez)	10568, 20531, 84395
Formulation	PBS with 4mg trehalose and no preservative
Immunogen	A synthetic peptide corresponding to a sequence of human SLC34A2 (QNWTMKNVTYKENIAKCQHIFVNFHLPDLA).
Classification	Polyclonal
Primary or Secondary	Primary

2,447

Invitrogen™ VGAT Polyclonal Antibody

Rabbit Polyclonal Antibody

Pricing & Availability
Specifications

Content And Storage	Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles.
Target Species	Human,Mouse,Rat
Host Species	Rabbit
Conjugate	Unconjugated
Applications	Immunohistochemistry (Frozen),Immunohistochemistry (Paraffin),Western Blot,Immunocytochemistry
Form	Liquid
Gene Accession No.	O35458, O35633, Q9H598
Isotype	IgG
Concentration	0.52 mg/mL
Antigen	VGAT
Gene Symbols	SLC32A1
Regulatory Status	RUO
Purification Method	Antigen affinity chromatography
Gene Alias	GABA and glycine transporter; GVAT; hVIAAT; mVGAT; mVIAAT; R75019; rGVAT; SLC32A1; solute carrier family 32 (GABA vesicular transporter), member 1; solute carrier family 32 member 1; vasicular inhibitory amino acid transporter 10D; vesicular GABA transporter; Vesicular inhibitory amino acid transporter; Vgat; Viaat
Gene	SLC32A1
Product Type	Antibody
Gene ID (Entrez)	140679, 22348, 83612
Formulation	PBS with 20% glycerol and 0.025% ProClin 300; pH 7
Immunogen	Recombinant protein encompassing a sequence within the N-terminus region of human VGAT. The exact sequence is proprietary.
Classification	Polyclonal
Primary or Secondary	Primary

2,448

Invitrogen™ CD80 (B7-1) Polyclonal Antibody

Rabbit Polyclonal Antibody

Pricing & Availability
Specifications

Content And Storage	Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles.
Target Species	Human,Mouse
Host Species	Rabbit
Conjugate	Unconjugated
Applications	Western Blot,Immunocytochemistry,Immunohistochemistry,Western Blot
Form	Liquid
Gene Accession No.	P33681
Isotype	IgG
Concentration	0.8 mg/mL
Antigen	CD80 (B7-1)
Gene Symbols	CD80
Regulatory Status	RUO
Purification Method	Antigen affinity chromatography
Gene Alias	Activation B7-1 antigen; B7; B7 protein; B7.1; B71; B7-1; B7-1 protein; B7-1 protein precursor; BB1; B-lymphocyte activation antigen B7; Cd28l; CD28LG; CD28LG1; CD80; Cd80 a rat homolog of the human CD28/CTLA - 4 ligand (B7-1); CD80 anitgen; CD80 antigen; CD80 antigen (CD28 antigen ligand 1, B7-1 antigen); Cd80 molecule; CD80 protein precursor; costimulatory factor CD80; costimulatory molecule variant IgV-CD80; CTLA-4 counter-receptor B7.1; LAB7; Ly53; Ly-53; MIC17; sCD 80; sCD80; secreted B7-1 protein precursor; soluble CD 80; soluble CD80; T-cell costimulatory molecule; T-cell co-stimulatory protein B7-1; T-lymphocyte activation antigen CD80; TS/A-1; TSA1
Gene	CD80
Product Type	Antibody
Gene ID (Entrez)	941
Formulation	PBS with 40% Glycerol, 0.1% BSA and 0.05% sodium azide; pH 7.4
Immunogen	Recombinant protein within human cd80 aa 1-242.
Classification	Polyclonal
Primary or Secondary	Primary

2,449

Invitrogen™ PIEZO1 Polyclonal Antibody

Rabbit Polyclonal Antibody

Pricing & Availability
Specifications

Content And Storage	-20°C
Target Species	Human,Mouse,Rat
Host Species	Rabbit
Conjugate	Unconjugated
Applications	Immunohistochemistry (Paraffin),Western Blot,Immunocytochemistry
Form	Liquid
Gene Accession No.	E2JF22, Q0KL00, Q92508
Isotype	IgG
Concentration	1 mg/mL
Antigen	PIEZO1
Gene Symbols	Piezo1
Regulatory Status	RUO
Purification Method	Affinity chromatography
Gene Alias	9630020g22; DHS; Fam38a; family with sequence similarity 38, member A; KIAA0233; LMPH3; Membrane protein induced by beta-amyloid treatment; Mib; mKIAA0233; piezo type mechanosensitive ion channel component 1; Piezo1; piezo-type mechanosensitive ion channel component 1; Protein FAM38A; protein PIEZO1
Gene	Piezo1
Product Type	Antibody
Gene ID (Entrez)	234839, 361430, 9780
Formulation	PBS with 50% glycerol and 0.02% sodium azide; pH 7.4
Immunogen	A synthesized peptide derived from human PIEZO1(Accession Q92508), corresponding to amino acid residues I642-L692.
Classification	Polyclonal
Primary or Secondary	Primary

2,450

Invitrogen™ CD235a Polyclonal Antibody

Rabbit Polyclonal Antibody

Pricing & Availability
Specifications

Content And Storage	Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles.
Target Species	Human
Host Species	Rabbit
Conjugate	Unconjugated
Applications	Immunohistochemistry (Paraffin),Western Blot
Form	Liquid
Gene Accession No.	P02724
Isotype	IgG
Concentration	1 mg/mL
Antigen	CD235a
Gene Symbols	GYPA
Regulatory Status	RUO
Purification Method	Antigen affinity chromatography
Gene Alias	AI853584; CD235; CD235a; erythroid-lineage-specific membrane sialoglycoprotein; glycophorin A; glycophorin A (MN blood group); glycophorin A (MNS blood group); glycophorin A, GPA; glycophorin Erik; glycophorin MiI; glycophorin MiV; glycophorin SAT; glycophorin Sta type C; glycophorin-A; GPA; GPErik; GPSAT; Gypa; HGNC:4702; HGpMiV; HGpMiX; HGpMiXI; HGpSta(C); HGpStaC; Mi.V glycoprotein; Mi.V glycoprotein (24 AA); MN; MN sialoglycoprotein; MNS; PAS-2; recombinant glycophorin A-B Miltenberger-DR; sialoglycoprotein alpha
Gene	GYPA
Product Type	Antibody
Gene ID (Entrez)	2993
Formulation	PBS with 20% glycerol and 0.01% thimerosal; pH 7
Immunogen	Synthetic peptide encompassing a sequence within the Intracellular domain of human Glycophorin A. The exact sequence is proprietary.
Classification	Polyclonal
Primary or Secondary	Primary

2,451

Invitrogen™ CD213a1 (IL-13Ra1) Monoclonal Antibody (13MOKA), PE, eBioscience™

Rat Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	4°C, store in dark, DO NOT FREEZE!
Target Species	Mouse
Host Species	Rat
Conjugate	PE
Applications	Flow Cytometry
Form	Liquid
Gene Accession No.	O09030
Isotype	IgG2a κ
Concentration	0.2 mg/mL
Antigen	CD213a1 (IL-13Ra1)
Gene Symbols	IL13RA1
Regulatory Status	RUO
Purification Method	Affinity chromatography
Gene Alias	AI882074; Cancer/testis antigen 19; CD antigen CD213a1; CD213a1; CD213a1 antigen; CT19; IL13 receptor alpha-1 chain; IL-13 receptor subunit alpha-1; IL13R; IL-13R subunit alpha-1; IL-13r[a]; IL13RA; IL-13Ra; IL13RA1; IL-13RA1; IL-13R-alpha-1; interleukin 13 receptor subunit alpha 1; interleukin 13 receptor, alpha 1; interleukin 13 receptor, alpha 1-like; interleukin-13 receptor subunit alpha-1; Interleukin-13-binding protein; LOC100360218; Novel cytokine receptor 4; NR4
Gene	IL13RA1
Product Type	Antibody
Gene ID (Entrez)	16164
Formulation	PBS with 0.09% sodium azide; pH 7.2
Classification	Monoclonal
Primary or Secondary	Primary
Clone	13MOKA

2,452

MHC Class I (H-2Kb) Monoclonal Antibody (AF6-88.5.5.3), PE, eBioscience™, Invitrogen™

Mouse Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	4°C, store in dark, DO NOT FREEZE!
Target Species	Mouse
Host Species	Mouse
Conjugate	PE
Applications	Flow Cytometry
Form	Liquid
Isotype	IgG2a κ
Gene Accession No.	P01901, P03991, P04223, P14428
Concentration	0.2 mg/mL
Antigen	MHC Class I (H-2Kb)
Gene Symbols	H2-K1
Regulatory Status	RUO
Purification Method	Affinity chromatography
Gene Alias	class I major histocompatibility antigen H-2Kd; H-2 class I histocompatibility antigen, K-B alpha chain; H-2 class I histocompatibility antigen, K-D alpha chain; H-2 class I histocompatibility antigen, K-K alpha chain; H-2 class I histocompatibility antigen, K-Q alpha chain; H-2 class I histocompatibility antigen, K-W28 alpha chain; H-2K; H2-K; H-2K(B); H-2K(d); H-2K(K); H-2K(Q); H2-K1; histocompatibility 2, K1, K region; K-f; MHC class I antigen; MHC class I H2-K-b-alpha-2 cell surface glycoprotein; MHC class I heavy chain H2-K; MHC H2-K transplantation antigen
Gene	H2-K1
Product Type	Antibody
Gene ID (Entrez)	14972
Formulation	PBS with 0.09% sodium azide; pH 7.2
Classification	Monoclonal
Primary or Secondary	Primary
Clone	AF6-88.5.5.3

2,453

Invitrogen™ PLP1 Polyclonal Antibody

Rabbit Polyclonal Antibody

Pricing & Availability
Specifications

Content And Storage	-20°C, Avoid Freeze/Thaw Cycles
Target Species	Human,Mouse
Host Species	Rabbit
Conjugate	Unconjugated
Applications	Immunohistochemistry,Western Blot,Immunocytochemistry
Form	Liquid
Gene Accession No.	P60201, P60202
Isotype	IgG
Concentration	0.5 mg/mL
Antigen	PLP1
Gene Symbols	PLP1
Regulatory Status	RUO
Purification Method	Affinity Chromatography
Gene Alias	DM20; GPM6C; HLD1; jimpy; jp; lipophilin; lipophilin (aa 129 to 276); major myelin proteolipid protein; MMPL; msd; Myelin proteolipid protein; myelin synthesis deficiency; PLP; PLP/DM20; Plp1; PMD; proteolipid; proteolipid protein; proteolipid protein (myelin) 1; Proteolipid protein (Pelizaeus-Merzbacher disease spastic paraplegia 2 uncomplicated); Proteolipid protein (Pelizaeus-Merzbacher disease, spastic paraplegia 2, uncomplicated); proteolipid protein 1; proteolipid protein 1 (Pelizaeus-Merzbacher disease, spastic paraplegia 2, uncomplicated); proteolipid protein, lipophilin; rsh; rump shaker; SPG2
Gene	PLP1
Product Type	Antibody
Gene ID (Entrez)	18823, 5354
Formulation	PBS with 2% sucrose and 0.09% sodium azide
Immunogen	Synthetic peptide directed towards the N-terminal of human PLP1 (aa 36-85).
Classification	Polyclonal
Primary or Secondary	Primary

2,454

Invitrogen™ RGS1 Recombinant Rabbit Monoclonal Antibody (HL1402)

Rabbit Recombinant Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles.
Target Species	Human,Mouse
Host Species	Rabbit
Conjugate	Unconjugated
Applications	Immunohistochemistry (Paraffin),Western Blot,Immunocytochemistry
Form	Liquid
Gene Accession No.	Q08116, Q9JL25
Isotype	IgG
Concentration	1 mg/mL
Antigen	RGS1
Gene Symbols	RGS1
Regulatory Status	RUO
Purification Method	Protein A
Gene Alias	1R20; B-cell activation protein BL34; BL34; Early response protein 1R20; epididymis secretory protein Li 87; HEL-S-87; IER1; immediate-early response 1, B-cell specific; IR20; Regulator of G-protein signaling 1; regulator of G-protein signalling 1; RGS1
Gene	RGS1
Product Type	Antibody
Gene ID (Entrez)	50778, 5996
Formulation	PBS with no preservative
Immunogen	Recombinant protein encompassing a sequence within the center region of human RGS1. The exact sequence is proprietary.
Classification	Recombinant Monoclonal
Primary or Secondary	Primary
Clone	HL1402

2,455

CD117 (c-Kit) Monoclonal Antibody (ACK2), Super Bright™ 702, eBioscience™, Invitrogen™

Rat Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	4°C, store in dark, DO NOT FREEZE!
Target Species	Mouse
Host Species	Rat
Conjugate	Super Bright 702
Applications	Flow Cytometry
Form	Liquid
Isotype	IgG2b κ
Gene Accession No.	P05532
Antigen	CD117 (c-Kit)
Regulatory Status	RUO
Purification Method	Affinity chromatography
Product Type	Antibody
Gene ID (Entrez)	16590
Classification	Monoclonal
Primary or Secondary	Primary
Clone	ACK2

2,456

CD294 (CRTH2) Monoclonal Antibody (BM16), PE-Cyanine5, eBioscience™, Invitrogen™

Rat Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	4°C, store in dark, DO NOT FREEZE!
Target Species	Human
Host Species	Rat
Conjugate	PE-Cyanine5
Applications	Flow Cytometry
Form	Liquid
Isotype	IgG2a κ
Gene Accession No.	Q9Y5Y4
Concentration	5 μL/Test
Antigen	CD294 (CRTH2)
Gene Symbols	PTGDR2
Regulatory Status	RUO
Purification Method	Affinity chromatography
Gene Alias	CD294; chemoattractant receptor homologous molecule expressed on T helper type 2 cells; chemoattractant receptor-homologous molecule expressed on TH2 cells; CRTH2; DL1R; DP2; G protein-coupled receptor 44; Gpr44; G-protein coupled receptor 44; Grp45; MGC130436; PGD2 receptor; prostaglandin D2 receptor 2; prostaglandin D2 receptor CRTH2; Ptgdr2; putative G-protein coupled receptor 44
Gene	PTGDR2
Product Type	Antibody
Gene ID (Entrez)	11251
Formulation	PBS with BSA and 0.09% sodium azide; pH 7.2
Classification	Monoclonal
Primary or Secondary	Primary
Clone	BM16

2,457

Invitrogen™ Golgin-97 Polyclonal Antibody

Rabbit Polyclonal Antibody

Pricing & Availability
Specifications

Content And Storage	Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles.
Target Species	Hamster,Human,Mouse
Host Species	Rabbit
Conjugate	Unconjugated
Applications	Western Blot,Immunocytochemistry
Form	Liquid
Gene Accession No.	Q92805, Q9CW79
Isotype	IgG
Concentration	1 mg/mL
Antigen	Golgin-97
Gene Symbols	GOLGA1
Regulatory Status	RUO
Purification Method	Antigen affinity chromatography
Gene Alias	0710001G09Rik; 2210418B03Rik; AW107649; gap junction protein, alpha 4, 37kD; Golga1; golgi autoantigen, golgin subfamily a, 1; Golgi97; golgin A1; golgin subfamily A member 1; golgin-97
Gene	GOLGA1
Product Type	Antibody
Gene ID (Entrez)	100751002, 2800, 76899
Formulation	PBS with no preservative; pH 7
Immunogen	Recombinant protein encompassing a sequence within the C-terminus region of human Golgin 97. The exact sequence is proprietary.
Classification	Polyclonal
Primary or Secondary	Primary

2,458

TCR alpha/beta Monoclonal Antibody (WT31), PE, eBioscience™, Invitrogen™

Mouse Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	4°C, store in dark, DO NOT FREEZE!
Target Species	Human
Host Species	Mouse
Conjugate	PE
Applications	Flow Cytometry
Form	Liquid
Isotype	IgG1 κ
Concentration	5 μL/Test
Antigen	TCR alpha/beta
Regulatory Status	RUO
Purification Method	Affinity chromatography
Product Type	Antibody
Classification	Monoclonal
Primary or Secondary	Primary
Clone	WT31

2,459

Invitrogen™ CD36 Monoclonal Antibody (CB38 (NL07)), APC

Mouse Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	4°C, store in dark, DO NOT FREEZE!
Target Species	Human
Host Species	Mouse
Conjugate	APC
Applications	Flow Cytometry
Form	Liquid
Gene Accession No.	P16671
Isotype	IgM κ
Antigen	CD36
Gene Symbols	CD36
Regulatory Status	RUO
Purification Method	Size-exclusion chromatography
Gene Alias	adipocyte membrane protein; BDPLT10; Cd36; CD36 antigen; CD36 antigen (collagen type I receptor, thrombospondin receptor); CD36 molecule; CD36 molecule (thrombospondin receptor); CD36 protein; CHDS7; cluster determinant 36; collagen type I receptor thrombospondin receptor; collagen type I receptor, thrombospondin receptor; FAT; FAT/CD36; fatty acid translocase; fatty acid translocase/CD36; fatty acid transport protein; glycoprotein IIIb; GP3B; GP4; GPIIIB; GPIV; I79_011940; Leukocyte differentiation antigen CD36; PAS IV; PAS4; PAS-4; PAS-4 protein; PASIV; Platelet collagen receptor; Platelet glycoprotein 4; platelet glycoprotein IV; Scarb3; scavenger receptor class B, member 3; SR-B3; Thrombospondin receptor
Gene	CD36
Product Type	Antibody
Gene ID (Entrez)	948
Formulation	MES with 0.2% BSA and 15mM sodium azide; pH 8.0
Immunogen	living human myeloid cells.
Classification	Monoclonal
Primary or Secondary	Primary
Clone	CB38 (NL07)

2,460

Invitrogen™ CD31 Monoclonal Antibody (390), FITC

Rat Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	4°C, store in dark
Target Species	Mouse
Host Species	Rat
Conjugate	FITC
Applications	Flow Cytometry
Form	Liquid
Gene Accession No.	Q08481
Isotype	IgG2a κ
Antigen	CD31
Gene Symbols	Pecam1
Regulatory Status	RUO
Purification Method	Purified
Gene Alias	C85791; CD31; CD31 antigen; CD31, PECAM-1; CD31/EndoCAM; endoCAM; GPIIA'; I79_008304; PECA1; Pecam; PECAM1; Pecam-1; platelet and endothelial cell adhesion molecule 1; platelet endothelial cell adhesion molecule; platelet endothelial cell adhesion molecule-1; platelet/endothelial cell adhesion molecule (CD31 antigen); platelet/endothelial cell adhesion molecule 1; type I transmembrane endothelial adhesion molecule
Gene	Pecam1
Product Type	Antibody
Gene ID (Entrez)	18613
Formulation	PBS with 0.1% sodium azide
Immunogen	Mouse 32D leukocyte cell line.
Classification	Monoclonal
Primary or Secondary	Primary
Clone	390

Primary Antibodies

Filtered Search Results

Narrow Results

Invitrogen™ SLC34A2 Polyclonal Antibody Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ VGAT Polyclonal Antibody Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ CD80 (B7-1) Polyclonal Antibody Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ PIEZO1 Polyclonal Antibody Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ CD235a Polyclonal Antibody Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ CD213a1 (IL-13Ra1) Monoclonal Antibody (13MOKA), PE, eBioscience™ Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

MHC Class I (H-2Kb) Monoclonal Antibody (AF6-88.5.5.3), PE, eBioscience™, Invitrogen™ Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ PLP1 Polyclonal Antibody Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ RGS1 Recombinant Rabbit Monoclonal Antibody (HL1402) Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

CD117 (c-Kit) Monoclonal Antibody (ACK2), Super Bright™ 702, eBioscience™, Invitrogen™ Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

CD294 (CRTH2) Monoclonal Antibody (BM16), PE-Cyanine5, eBioscience™, Invitrogen™ Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ Golgin-97 Polyclonal Antibody Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

TCR alpha/beta Monoclonal Antibody (WT31), PE, eBioscience™, Invitrogen™ Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ CD36 Monoclonal Antibody (CB38 (NL07)), APC Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ CD31 Monoclonal Antibody (390), FITC Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ SLC34A2 Polyclonal Antibody

Invitrogen™ VGAT Polyclonal Antibody

Invitrogen™ CD80 (B7-1) Polyclonal Antibody

Invitrogen™ PIEZO1 Polyclonal Antibody

Invitrogen™ CD235a Polyclonal Antibody

Invitrogen™ CD213a1 (IL-13Ra1) Monoclonal Antibody (13MOKA), PE, eBioscience™

MHC Class I (H-2Kb) Monoclonal Antibody (AF6-88.5.5.3), PE, eBioscience™, Invitrogen™

Invitrogen™ PLP1 Polyclonal Antibody

Invitrogen™ RGS1 Recombinant Rabbit Monoclonal Antibody (HL1402)

CD117 (c-Kit) Monoclonal Antibody (ACK2), Super Bright™ 702, eBioscience™, Invitrogen™

CD294 (CRTH2) Monoclonal Antibody (BM16), PE-Cyanine5, eBioscience™, Invitrogen™

Invitrogen™ Golgin-97 Polyclonal Antibody

TCR alpha/beta Monoclonal Antibody (WT31), PE, eBioscience™, Invitrogen™

Invitrogen™ CD36 Monoclonal Antibody (CB38 (NL07)), APC

Invitrogen™ CD31 Monoclonal Antibody (390), FITC