All Primary Antibodies
Primary antibodies, immunoglobulins that bind to specific proteins or other biomolecules, are used in many research applications and protocols to detect targets of interest. They are developed using different animal hosts, including mouse, rat, rabbit, goat, sheep, and many others.
Monoclonal and Polyclonal Antibodies
One type of primary antibodies, monoclonal antibodies, provides high reproducibility and low cross-reactivity and background noise. Another type, polyclonal antibodies, often costs less and provides greater affinity and quicker binding. Both are produced using plasma B cells, but the former uses the same clone and the latter uses different clones. Monoclonal antibodies require hybridoma cell lines, and polyclonal antibodies do not.
There are also recombinant monoclonal antibodies with similar benefits, like high affinity, scalability, and specificity. They are produced using in vitro cloning of plasma B cells and expression hosts.
Conjugated Primary Antibodies
Antibodies can be labeled with various fluorophores or detection agents or used without labels. Labeled primary antibodies, also known as conjugated primary antibodies, help researchers simplify and streamline their applications. They are coupled with common enzymes and dyes such as Alexa Fluor and often used in protein and cell analysis.
Applications
Antibodies for life sciences applications are used in flow cytometry, western blotting, ELISA, immunohistochemistry, and immunocytochemistry. Secondary antibodies can be added to support the detection and purification of certain antigens. They bind to the primary antibody, which binds to the antigen of interest. Finding the right combination of antibodies can result in greater antigen specificity and a strong, detectable signal.
- (1)
- (7)
- (2)
- (3,051)
- (925)
- (1,939)
- (4,412)
- (1)
- (1)
- (3)
- (1)
- (1,258)
- (1,754)
- (921,451)
- (21,592)
- (2)
- (774)
- (61)
- (1)
- (29)
- (1)
- (5,588)
- (3,360)
- (1,862)
- (218)
- (1)
- (8,787)
- (12,059)
- (2,271)
- (9)
- (52)
- (1)
- (3)
- (4)
- (13)
- (2)
- (69)
- (5)
- (11)
- (12,287)
- (15,878)
- (10,955)
- (1)
- (1)
- (4)
- (1)
- (239)
- (78)
- (13)
- (2,669)
- (535)
- (1)
- (1)
- (136)
- (422)
- (3)
- (1)
- (3)
- (16)
- (110)
- (1)
- (190,004)
- (288,112)
- (1)
- (19)
- (798)
- (1)
- (12,214)
- (2)
- (129)
- (1)
- (2)
- (5)
- (11)
- (4)
- (9)
- (1)
- (2)
- (12)
- (34)
- (3)
- (1)
- (4)
- (1)
- (108)
- (1)
- (20)
- (19)
- (46)
- (1)
- (5)
- (1)
- (1)
- (10,751)
- (652)
- (1)
- (2)
- (1)
- (4)
- (6)
- (6)
- (1)
- (8)
- (3)
- (16)
- (2)
- (2)
- (329)
- (359)
- (5)
- (13,005)
- (2)
- (4,300)
- (2,250)
- (1)
- (14)
- (33)
- (1)
- (7)
- (1)
- (6,040)
- (3,903)
- (1)
- (20)
- (1)
- (1)
- (2)
- (40)
- (1)
- (2)
- (1)
- (17,537)
- (16,767)
- (18)
- (1)
- (1)
- (1)
- (5,545)
- (3)
- (2)
- (43)
- (4)
- (13)
- (1)
- (164)
- (748)
- (17)
- (2)
- (6)
- (1)
- (1)
- (2)
- (2,085)
- (1)
- (9)
- (3)
- (1)
- (1)
- (2)
- (6)
- (2)
- (2)
- (104)
- (1)
- (1)
- (3,866)
- (2)
- (20)
- (3)
- (112)
- (1)
- (1)
- (5)
- (2)
- (3)
- (33)
- (1)
- (5)
- (187)
- (2)
- (4,823)
- (12)
- (1)
- (2)
- (5)
- (9)
- (4)
- (7)
- (23)
- (130)
- (8,934)
- (39,658)
- (448)
- (53)
- (1,929)
- (1)
- (36)
- (7)
- (1)
- (2,681)
- (1)
- (4,478)
- (42)
- (2)
- (2)
- (1)
- (1)
- (4)
- (50)
- (1)
- (1)
- (815)
- (1)
- (1)
- (2)
- (2)
- (32)
- (40)
- (4)
- (6)
- (3)
- (6)
- (1)
- (3)
- (1)
- (3)
- (3)
- (31,161)
- (9)
- (1)
- (29)
- (2,893)
- (74)
- (89)
- (275)
- (2)
- (55)
- (29,965)
- (29,827)
- (6)
- (32,470)
- (16)
- (29,774)
- (45)
- (866)
- (48)
- (595)
- (30,794)
- (1)
- (32,527)
- (1)
- (3)
- (1)
- (73)
- (3)
- (30,317)
- (29,972)
- (3)
- (24,399)
- (24,961)
- (24,935)
- (24,831)
- (24,992)
- (24,794)
- (23)
- (127)
- (5)
- (103)
- (106)
- (2)
- (1)
- (92)
- (6)
- (15)
- (5)
- (34,906)
- (11)
- (3)
- (221)
- (761)
- (1,054)
- (721)
- (777)
- (920)
- (889)
- (1,009)
- (850)
- (1,470)
- (910)
- (835)
- (1,058)
- (1,059)
- (1,056)
- (681)
- (1,087)
- (30,490)
- (90)
- (9)
- (42)
- (17)
- (1)
- (103)
- (1)
- (139)
- (3)
- (79)
- (28,930)
- (28,983)
- (29,280)
- (63)
- (28,999)
- (25,597)
- (1)
- (60)
- (28,922)
- (28,575)
- (28,539)
- (17)
- (9)
- (1)
- (1)
- (7)
- (5)
- (33,652)
- (5)
- (30)
- (1)
- (1)
- (338)
- (734)
- (30,825)
- (1)
- (30,923)
- (27,238)
- (17,685)
- (17,678)
- (27,221)
- (30,927)
- (38)
- (1)
- (47)
- (9)
- (13)
- (2)
- (99)
- (11)
- (22)
- (58)
- (26)
- (127)
- (158)
- (25)
- (84)
- (58)
- (24)
- (56)
- (75)
- (9)
- (65)
- (73)
- (95)
- (84)
- (78)
- (28)
- (64)
- (70)
- (44)
- (58)
- (50)
- (53)
- (98)
- (122)
- (41)
- (58)
- (65)
- (77)
- (75)
- (454)
- (32,847)
- (7)
- (4)
- (311)
- (417)
- (2,778)
- (3,757)
- (24)
- (3)
- (37)
- (214)
- (2,662)
- (155)
- (41)
- (27,786)
- (558)
- (535)
- (6)
- (12)
- (13)
- (5)
- (6)
- (1,229)
- (858)
- (142)
- (536)
- (429)
- (878)
- (402)
- (325)
- (815)
- (756)
- (721)
- (2)
- (630)
- (722)
- (290)
- (752)
- (822)
- (634)
- (807)
- (12)
- (29)
- (116)
- (5)
- (274)
- (250)
- (125)
- (126)
- (95)
- (46)
- (11)
- (6)
- (5)
- (9)
- (3)
- (8)
- (2)
- (64)
- (14)
- (542,619)
- (7)
- (266)
- (49)
- (2)
- (367)
- (68)
- (47)
- (25)
- (271)
- (3)
- (3)
- (4)
- (29,993)
- (30,024)
- (29,977)
- (564)
- (2,894)
- (51)
- (1)
- (15)
- (1,780)
- (726)
- (3)
- (2)
- (6)
- (4)
- (5)
- (111,671)
- (68)
- (124)
- (2,111)
- (31,234)
- (221)
- (8)
- (23)
- (597,686)
- (16)
- (1)
- (800,240)
- (84,198)
- (3)
- (45,150)
- (174)
- (1)
- (1)
- (571)
- (2)
- (36)
- (23)
- (187)
- (1,232)
- (3)
- (4)
- (468)
- (98)
- (1)
- (1,429)
- (3)
- (2)
- (7)
- (2)
- (127)
- (2)
- (9)
- (95)
- (164)
- (51)
- (745)
- (1)
- (5)
- (8,432)
- (7,041)
- (12)
- (2)
- (1)
- (27)
- (27)
- (6)
- (161)
- (292)
- (1)
- (74)
- (2)
- (10,238)
- (43)
- (425)
- (171)
- (2,278)
- (156)
- (6)
- (348)
- (2)
- (1)
- (120)
- (1)
- (9)
- (10)
- (27)
- (84)
- (2)
- (23)
- (1)
- (677)
- (56)
- (8)
- (21)
- (109,131)
- (2)
- (2)
- (57)
- (70)
- (275)
- (18)
- (1,253)
- (6,085)
- (2)
- (7)
- (2)
- (2,152)
- (6)
- (57)
- (432,706)
- (31)
- (20,758)
- (15,649)
- (1,535)
- (377)
- (219)
- (79)
- (10,492)
- (4)
- (170)
- (28)
- (2)
- (28)
- (25)
- (1,047)
- (7)
- (2)
- (9)
- (18)
- (2)
- (1)
- (2)
- (92)
- (10)
- (2)
- (349,510)
- (2,675)
- (43,522)
- (93)
- (2)
- (50)
- (41)
- (1)
- (1)
- (4)
- (167)
- (2)
- (32,418)
- (127)
- (2)
- (1)
- (2)
- (150)
- (893)
- (15,271)
- (3)
- (2)
- (168)
- (30)
- (2)
- (2)
- (10)
- (819)
- (3)
- (2)
- (2)
- (2)
- (2)
- (10)
- (87)
- (64)
- (3)
- (337)
- (1,422)
- (2,837)
- (4)
- (290,189)
- (153,811)
- (191)
- (53)
- (197,229)
- (502,586)
- (77)
- (1,445)
- (43,005)
- (14)
- (267)
- (12,831)
- (529,532)
- (202)
- (609)
- (2)
- (3)
- (551)
- (6)
- (4)
- (211,657)
- (2,647)
- (27)
- (10)
- (51)
- (526)
- (25)
- (270)
- (1,156)
- (1,424)
- (7)
- (8)
- (1,339)
- (4)
- (2)
- (3)
- (26)
- (6,535)
- (1)
- (6)
- (814)
- (32)
- (9)
- (2)
- (434)
- (4)
- (4)
- (2)
- (22)
- (48)
- (1,208)
- (2)
- (16)
- (1,835)
- (1)
- (4)
- (2)
- (261)
- (437)
- (1,280)
- (39)
- (6)
- (43,437)
- (22)
- (1)
- (917)
- (85)
- (835)
- (1,910)
- (5)
- (2)
- (3)
- (2)
- (2)
- (22,381)
- (10)
- (1)
- (4)
- (1,390)
- (9)
- (2)
- (4)
- (135)
- (2)
- (1)
- (2,798)
- (105)
- (3)
- (13)
- (33)
- (1,513)
- (5)
- (2)
- (9,778)
- (4,867)
- (3,679)
- (1)
- (41)
- (11)
- (4,367)
- (2)
- (460)
- (442)
- (4)
- (26)
- (14)
- (52)
- (14)
- (2,645)
- (258)
- (3)
- (1)
- (1)
- (29)
- (13)
- (39)
- (2)
- (1)
- (2)
- (3)
- (1)
- (2)
- (1)
- (1,080,906)
- (3)
- (9,440)
- (19)
- (1)
- (51)
- (10)
- (74)
- (3)
- (3)
- (90)
- (40)
- (106)
- (494)
- (5)
- (728)
- (150)
- (62)
- (882)
- (8)
- (35)
- (8)
- (22)
- (5)
- (4)
- (2)
- (867)
- (2)
- (2,269)
- (51)
- (2)
- (5,101)
- (436)
- (1)
- (4)
- (24)
- (3)
- (4)
- (4)
- (8)
- (1)
- (2)
- (19,897)
- (1,027)
- (2,074)
- (426)
- (62)
- (1,190)
- (4)
- (9)
- (53)
- (9)
- (4)
- (47)
- (8)
- (29,698)
- (821)
- (2)
- (2)
- (4)
- (8)
- (5)
- (1,307)
- (9,923)
- (376)
- (1,447)
- (20)
- (855)
- (4)
- (2)
- (30)
- (2)
- (1)
- (1,022)
- (3)
- (9)
- (1)
- (18)
- (3)
- (2)
- (1,266)
- (3,505)
- (371)
- (2)
- (42)
- (5)
- (3)
- (4)
- (3)
- (6)
- (1,889)
- (12)
- (39)
- (4)
- (2,383)
- (164)
- (135)
- (50)
- (1,477)
- (263)
- (2)
- (14)
- (18)
- (1)
- (21)
- (4,674)
- (173)
- (44)
- (1)
- (2)
- (2)
- (5,218)
- (68)
- (578)
- (300)
- (3)
- (108)
- (1)
- (1,572)
- (43)
- (4)
- (2)
- (9)
- (497)
- (21)
- (352)
- (3)
- (3)
- (6)
- (149)
- (145)
- (1)
- (1,779)
- (126)
- (168)
- (42)
- (3)
- (2)
- (176)
- (1)
- (2)
- (36)
- (3,494)
- (218)
- (407)
- (1)
- (274)
- (240)
- (236)
- (160)
- (9)
- (15)
- (11)
- (5)
- (5,223)
- (308)
- (6)
- (10)
- (1)
- (4)
- (52)
- (23)
- (73)
- (2)
- (28)
- (709)
- (1,433,702)
- (695)
- (9)
- (19)
- (1)
- (5)
- (78)
- (519)
- (89)
- (57)
- (15)
- (80)
- (42)
- (441)
- (524)
- (3)
- (15)
- (4)
- (17)
- (107)
- (9)
- (17)
- (2)
- (24)
- (1)
- (24)
- (2)
- (2)
- (16)
- (59)
- (2)
- (18)
- (2)
- (496)
- (8)
- (1)
- (890)
- (1,201)
- (2)
- (8)
- (4)
- (59)
- (139)
- (4)
- (268)
- (1)
- (13)
- (23,997)
- (90)
- (8)
- (2)
- (3)
- (1)
- (571,371)
- (4,877)
- (1,533)
- (1)
- (254)
- (2)
- (3)
- (30)
- (28)
- (8)
- (798)
- (7,444)
- (5)
- (4)
- (46)
- (1,310)
- (23)
- (279)
- (113)
- (1)
- (143)
- (182)
- (1)
- (3)
- (13)
- (20)
- (62)
- (5)
- (6)
- (9)
- (17)
- (207)
- (18)
- (18,491)
- (545)
- (215)
- (25)
- (1,234)
- (6)
- (1)
- (3)
- (1)
- (3)
- (124)
- (11)
- (5)
- (14,722)
- (155)
- (401)
- (10)
- (4)
- (6)
- (62)
- (10,253)
- (532)
- (4)
- (10)
- (2)
- (338,682)
- (5,177)
- (2)
- (6)
- (399)
- (2)
- (33)
- (2,777)
- (1,119)
- (3)
- (10)
- (30)
- (65)
- (153)
- (57)
- (2)
- (247)
- (31)
- (36)
- (3)
- (951)
- (2)
- (5,182)
- (2)
- (1)
- (15)
- (2)
- (22)
- (1)
- (1)
- (2)
- (13)
- (1)
- (2)
- (1)
- (13)
- (3,894)
- (471)
- (1)
- (2)
- (19)
- (5)
- (6)
- (3)
- (9)
- (54)
- (8)
- (3)
- (1)
- (4)
- (87)
- (10)
- (2)
- (24)
- (2)
- (2)
- (42)
- (3)
- (2)
- (2)
- (23)
- (82)
- (2,574)
- (1)
- (8)
- (23)
- (2)
- (3)
- (1,402)
- (6)
- (22)
- (13)
- (4)
- (4)
- (202)
- (5)
- (1,337)
- (38)
- (6)
- (3)
- (19,930)
- (2)
- (50)
- (2)
- (5)
- (3)
- (148)
- (339)
- (183)
- (2,287)
- (1,820)
- (30)
- (16)
- (2)
- (2)
- (4,513)
- (5)
- (9)
Filtered Search Results
CD16 Monoclonal Antibody (B73.1), Functional Grade, eBioscience™, Invitrogen™
Greener Choice
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Mouse Monoclonal Antibody
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
| Content And Storage | 4°C |
|---|---|
| Target Species | Human |
| Host Species | Mouse |
| Conjugate | Functional Grade |
| Applications | Flow Cytometry,Functional Assay,Neutralization |
| Form | Liquid |
| Isotype | IgG1 κ |
| Gene Accession No. | O75015, P08637 |
| Concentration | 1 mg/mL |
| Antigen | CD16 |
| Gene Symbols | FCGR3A, FCGR3B |
| Regulatory Status | RUO |
| Purification Method | Affinity chromatography |
| Gene Alias | 4833442P21Rik; CD16; CD16-2; CD16A; CD16a antigen; CD16b; CD32; CD32 receptor 2; CDw32; cytolytic trigger molecule G7; Fc fragment of IgG intermediate affinity IV receptor; Fc fragment of IgG low affinity IIIa receptor; Fc fragment of IgG receptor IIIa; Fc fragment of IgG receptor IIIb; Fc fragment of IgG, low affinity III, receptor for (CD16); Fc fragment of IgG, low affinity IIIa, receptor; Fc fragment of IgG, low affinity IIIa, receptor (CD16a); Fc fragment of IgG, low affinity IIIa, receptor for (CD16); Fc fragment of IgG, low affinity IIIa, receptor for (CD16); Fc fragment of IgG, low affinity III, receptor for (CD16); Fc fragment of IgG, low affinity IIIb, receptor (CD16b); Fc gamma receptor III; Fc gamma receptor IIIa; Fc gamma receptor III-A; Fc gamma receptor IIIb; Fc gamma RIIIa; Fc gammaRIV; Fc receptor, IgG, low affinity III; Fc receptor, IgG, low affinity IV; Fc receptor-like 3; Fcg receptor III; FCG2; FCG3; Fc-gamma receptor III-2 (CD 16); Fc-gamma receptor IIIb (CD 16); Fc-gamma receptor IIIb (CD16); Fc-gamma RII-b; Fc-gamma RII-c; fc-gamma RIII; Fc-gamma RIIIa; Fc-gamma RIII-alpha; fc-gamma RIIIb; fc-gamma RIII-beta; Fc-gamma-RIIb; Fc-gamma-RIIc; FcgammaRIII; FcgammaRIII a.1; FcgammaRIII a.2; FcgammaRIII a.3; FcgammaRIIIA; FcgammaRIV; FCGR2; FCGR2A; FCGR2B; FCGR2C; FCGR3; Fcgr3a; FCGR3B; Fcgr4; FCGRIII; FcgRIV; FcR-10; FcRII-b; FcRII-c; FcRIII; FCRIIIA; FCRIIIb; Fcrl3; IGFR3; IgG Fc gamma receptor III; igG Fc receptor III; IgG Fc receptor III-1; igG Fc receptor III-2; IMD20; immunoglobulin G Fc receptor III; LOC100911825; Low affinity immunoglobulin gamma Fc region receptor III; low affinity immunoglobulin gamma Fc region receptor III-A; Low affinity immunoglobulin gamma Fc region receptor III-B; low affinity immunoglobulin gamma Fc region receptor III-like; Low affinity immunoglobulin gamma Fc region receptor IV; neutrophil-specific antigen NA; RP11-5K23.1; transmembrane receptor FcgammaRIII-X |
| Product Type | Antibody |
| Gene ID (Entrez) | 2214, 2215 |
| Formulation | PBS with no preservative; pH 7.2 |
| Classification | Monoclonal |
| Primary or Secondary | Primary |
| Clone | B73.1 |
Invitrogen™ Phospho-eIF2b epsilon (Ser539) Polyclonal Antibody
Greener Choice
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Rabbit Polyclonal Antibody
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
| Content And Storage | -20°C |
|---|---|
| Target Species | Human,Mouse,Rat |
| Host Species | Rabbit |
| Conjugate | Unconjugated |
| Applications | Western Blot |
| Form | Liquid |
| Gene Accession No. | Q13144, Q64350, Q8CHW4 |
| Isotype | IgG |
| Antigen | Phospho-eIF2b epsilon (Ser539) |
| Gene Symbols | Eif2b5 |
| Regulatory Status | RUO |
| Purification Method | Antigen affinity chromatography |
| Gene Alias | C81315; CACH; CLE; EIF-2B; eIF-2B GDP-GTP exchange factor subunit epsilon; EIF2B5; EIF2BE; EIF2Bepsilon; eukaryotic translation initiation factor 2B subunit epsilon; eukaryotic translation initiation factor 2B, subunit 5 epsilon; eukaryotic translation initiation factor 2B, subunit 5 epsilon, 82kDa; initiation factor eIF-2Be; LVWM; Translation initiation factor eIF-2B subunit epsilon |
| Gene | Eif2b5 |
| Product Type | Antibody |
| Gene ID (Entrez) | 192234, 224045, 8893 |
| Formulation | Dulbecco's PBS with 1mg/mL BSA and 0.05% sodium azide; pH 7.3 |
| Immunogen | The antiserum was produced against a chemically synthesized phosphopeptide derived from the region of rat eIF2Be that contains serine 535 (corresponding to serine 539 in the human sequence). |
| Classification | Polyclonal |
| Primary or Secondary | Primary |
Invitrogen™ SARS-CoV-2 Spike Protein S1 Chimeric Recombinant Human Monoclonal Antibody (H6)
Greener Choice
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Human Recombinant Monoclonal Antibody
| Content And Storage | -20°C or -80°C if preferred |
|---|---|
| Target Species | Virus |
| Host Species | Human |
| Conjugate | Unconjugated |
| Applications | ELISA,Lateral Flow,Neutralization,Surface Plasmon Resonance |
| Form | Liquid |
| Isotype | IgG1 Fc |
| Concentration | 1 mg/mL |
| Antigen | SARS-CoV-2 Spike Protein S1 Chimeric |
| Regulatory Status | RUO |
| Purification Method | Affinity Chromatography |
| Gene Alias | Coronavirus; COVID; Covid 19; COVID19; COVID-19; SARS; SARS Coronavirus; SARS CoV; SARS CoV2; SARS CoV-2; SARS Spike Protein; SARS-CoV2; SARS-CoV-2 |
| Product Type | Antibody |
| Formulation | PBS with 50% glycerol and 0.03% ProClin 300; pH 7.4 |
| Immunogen | Recombinant Human Novel Coronavirus Spike glycoprotein (S) (16-685aa). |
| Classification | Recombinant Monoclonal |
| Primary or Secondary | Primary |
| Clone | H6 |
Invitrogen™ Human IgM Monoclonal Antibody (SA-DA4), Biotin, eBioscience™
Greener Choice
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Mouse Monoclonal Antibody
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
| Content And Storage | 4°C, store in dark, DO NOT FREEZE! |
|---|---|
| Target Species | Human |
| Host Species | Mouse |
| Conjugate | Biotin |
| Applications | Flow Cytometry,Immunohistochemistry |
| Form | Liquid |
| Gene Accession No. | P01871 |
| Isotype | IgG1 κ |
| Concentration | 0.5 mg/mL |
| Antigen | Human IgM |
| Gene Symbols | IGHM |
| Regulatory Status | RUO |
| Purification Method | Affinity chromatography |
| Gene Alias | AGM1; IGHM; immunoglobulin heavy constant mu; MU; VH |
| Gene | IGHM |
| Product Type | Antibody |
| Gene ID (Entrez) | 3507 |
| Formulation | PBS with 0.09% sodium azide; pH 7.2 |
| Classification | Monoclonal |
| Primary or Secondary | Primary |
| Clone | SA-DA4 |
Invitrogen™ GBX2 Polyclonal Antibody
Greener Choice
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Rabbit Polyclonal Antibody
| Content And Storage | Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles. |
|---|---|
| Target Species | Human,Mouse,Rat |
| Host Species | Rabbit |
| Conjugate | Unconjugated |
| Applications | Western Blot,Immunocytochemistry |
| Form | Liquid |
| Gene Accession No. | P48031, P52951 |
| Isotype | IgG |
| Concentration | 0.41 mg/mL |
| Antigen | GBX2 |
| Gene Symbols | GBX2 |
| Regulatory Status | RUO |
| Purification Method | Antigen Affinity Chromatography |
| Gene Alias | D130058E05Rik; gastrulation and brain-specific homeobox protein 2; gastrulation brain homeobox 2; Gbx2; Gbx-2; Homeobox protein GBX-2; LOW QUALITY PROTEIN: homeobox protein GBX-2; MMoxA; Stimulated by retinoic acid gene 7 protein; Stra7 |
| Gene | GBX2 |
| Product Type | Antibody |
| Gene ID (Entrez) | 114500, 14472, 2637 |
| Formulation | PBS with 1% BSA, 20% glycerol and 0.025% ProClin 300; pH 7 |
| Immunogen | Recombinant protein encompassing a sequence within the center region of human GBX2. The exact sequence is proprietary. |
| Classification | Polyclonal |
| Primary or Secondary | Primary |
Invitrogen™ Caspase 3 Polyclonal Antibody
Greener Choice
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Rabbit Polyclonal Antibody
| Content And Storage | Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles. |
|---|---|
| Target Species | Human,Mouse,Rat |
| Host Species | Rabbit |
| Conjugate | Unconjugated |
| Applications | Dot Blot,Immunohistochemistry (Frozen),Immunohistochemistry (Paraffin),Immunoprecipitation,Western Blot,Immunocytochemistry |
| Form | Liquid |
| Gene Accession No. | P42574, P55213, P70677 |
| Isotype | IgG |
| Concentration | 0.15 mg/mL |
| Antigen | Caspase 3 |
| Gene Symbols | CASP3 |
| Regulatory Status | RUO |
| Purification Method | Antigen affinity chromatography |
| Gene Alias | A830040C14Rik; AC-3; Apopain; Apopain precursor; Casp3; CASP-3; caspase 3; Caspase 3 apoptosis related cysteine protease (ICE-like cysteine protease); caspase 3, apoptosis related cysteine protease; Caspase 3, apoptosis related cysteine protease (ICE-like cysteine protease); caspase 3, apoptosis-related cysteine peptidase; caspase 3, apoptosis-related cysteine protease; Caspase3; caspase-3; Caspase-3 subunit p12; Caspase-3 subunit p17; Caspase-3-like protein; CC3; Cpp32; CPP-32; CPP32B; CPP32beta; cysteine protease CPP32; cysteine protease; CPP32; apopain; ICE3; IRP; LICE; mldy; PARP cleavage protease; procaspase3; protein Yama; SCA-1; SREBP cleavage activity 1; Yama; yama protein |
| Gene | CASP3 |
| Product Type | Antibody |
| Gene ID (Entrez) | 12367, 25402, 836 |
| Formulation | PBS with 20% glycerol, 1% BSA and 0.025% ProClin 300, pH 7 |
| Immunogen | Recombinant protein encompassing a sequence within the center region of human Caspase 3. The exact sequence is proprietary. |
| Classification | Polyclonal |
| Primary or Secondary | Primary |
Invitrogen™ Carbonic Anhydrase IX Polyclonal Antibody
Greener Choice
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Rabbit Polyclonal Antibody
| Content And Storage | Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles. |
|---|---|
| Target Species | Human,Mouse |
| Host Species | Rabbit |
| Conjugate | Unconjugated |
| Applications | Immunohistochemistry (Frozen),Immunohistochemistry (Paraffin),Western Blot,Immunocytochemistry |
| Form | Liquid |
| Gene Accession No. | Q16790, Q8VHB5 |
| Isotype | IgG |
| Concentration | 0.12 mg/mL |
| Antigen | Carbonic Anhydrase IX |
| Gene Symbols | CA9, Car9 |
| Regulatory Status | RUO |
| Purification Method | Antigen affinity chromatography |
| Gene Alias | Ca9; CA-9; CAIX; CA-IX; Car9; Carbonate dehydratase IX; carbonic anhydrase 9; Carbonic anhydrase IX; carbonic dehydratase; G250; Membrane antigen MN; membrane antigen MN homolog; MN; MN/CA9; P54 / 58N; P54/58N; pMW1; RCC-associated antigen G250; RCC-associated protein G250; renal cell carcinoma-associated antigen G250 |
| Gene | CA9 |
| Product Type | Antibody |
| Gene ID (Entrez) | 230099, 768 |
| Formulation | PBS with 20% glycerol, 1% BSA and 0.025% ProClin 300; pH 7 |
| Immunogen | Recombinant protein encompassing a sequence within the Extracellular domain of human Carbonic Anhydrase IX. The exact sequence is proprietary. |
| Classification | Polyclonal |
| Primary or Secondary | Primary |
Invitrogen™ SMARCA2 Polyclonal Antibody
Greener Choice
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Rabbit Polyclonal Antibody
| Content And Storage | Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles. |
|---|---|
| Target Species | Human,Mouse,Rat |
| Host Species | Rabbit |
| Conjugate | Unconjugated |
| Applications | Immunohistochemistry (Paraffin),Western Blot,Immunocytochemistry |
| Form | Liquid |
| Gene Accession No. | P51531, Q6DIC0 |
| Isotype | IgG |
| Concentration | 0.89 mg/mL |
| Antigen | SMARCA2 |
| Gene Symbols | SMARCA2 |
| Regulatory Status | RUO |
| Purification Method | Antigen affinity chromatography |
| Gene Alias | 2610209L14Rik; ATP-dependent helicase SMARCA2; BAF190; Baf190b; brahma; BRG1-associated factor 190B; BRM; FLJ36757; global transcription activator homologous sequence; hBRM; hSNF2a; MGC74511; NCBRS; Probable global transcription activator SNF2L2; protein brahma homolog; SMARCA2; SNF2; SNF2/SWI2-like protein 2; SNF2A; SNF2alpha; SNF2-alpha; Snf2l2; SNF2LA; Sth1p; subunit of the SWI/SNF chromatin remodeling complex; sucrose nonfermenting 2-like protein 2; SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily a, member 2; SWI/SNF-related matrix-associated actin-dependent regulator of chromatin a2; SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 2; SWI2 |
| Gene | SMARCA2 |
| Product Type | Antibody |
| Gene ID (Entrez) | 361745, 6595, 67155 |
| Formulation | PBS with 20% glycerol and 0.025% ProClin 300; pH 7 |
| Immunogen | Carrier-protein conjugated synthetic peptide encompassing a sequence within the N-terminus region of human SMARCA2. The exact sequence is proprietary. |
| Classification | Polyclonal |
| Primary or Secondary | Primary |
Invitrogen™ ROR2 Polyclonal Antibody
Greener Choice
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Rabbit Polyclonal Antibody
| Content And Storage | Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles. |
|---|---|
| Target Species | Human,Mouse,Rat |
| Host Species | Rabbit |
| Conjugate | Unconjugated |
| Applications | Immunohistochemistry,Western Blot |
| Form | Liquid |
| Gene Accession No. | Q01974, Q9Z138 |
| Isotype | IgG |
| Concentration | 1 mg/mL |
| Antigen | ROR2 |
| Gene Symbols | ROR2 |
| Regulatory Status | RUO |
| Purification Method | Antigen affinity chromatography |
| Gene Alias | BDB; BDB1; mRor2; neurotrophic tyrosine kinase receptor-related 2; neurotrophic tyrosine kinase, receptor related 2; neurotrophic tyrosine kinase, receptor-related 2; NTRKR2; receptor tyrosine kinase like orphan receptor 2; receptor tyrosine kinase-like orphan receptor 2; ROR2; Tyrosine-protein kinase transmembrane receptor ROR2 |
| Gene | ROR2 |
| Product Type | Antibody |
| Gene ID (Entrez) | 26564, 306782, 4920 |
| Formulation | PBS with 50% glycerol and 0.02% sodium azide; pH 7.2 |
| Immunogen | Recombinant full length Human ROR2. |
| Classification | Polyclonal |
| Primary or Secondary | Primary |
Invitrogen™ NGAL Polyclonal Antibody
Greener Choice
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Rabbit Polyclonal Antibody
| Content And Storage | -20°C |
|---|---|
| Target Species | Mouse,Rat |
| Host Species | Rabbit |
| Conjugate | Unconjugated |
| Applications | ELISA,Immunohistochemistry (Frozen),Immunohistochemistry (Paraffin),Western Blot |
| Form | Lyophilized |
| Gene Accession No. | P11672, P30152 |
| Isotype | IgG |
| Concentration | 500 μg/mL |
| Antigen | NGAL |
| Gene Symbols | LCN2 |
| Regulatory Status | RUO |
| Purification Method | Antigen affinity chromatography |
| Gene Alias | 24p3; 25 kDa alpha-2-microglobulin-related subunit of MMP-9; alpha-2-microglobulin-related protein; Alpha-2U globulin-related protein; AW212229; HGNC:6526; HNL; LCN2; lipocalin 2; lipocalin 2 (oncogene 24p3); Lipocalin 24p3; Lipocalin2; Lipocalin-2; migration-stimulating factor inhibitor; MSFI; neutrophil gelatinase-associated lipocalin; NGAL; oncogene 24p3; OTTHUMP00000022240; p25; RP23-161B9.11; secreted inducible protein 24; Siderocalin; Siderocalin LCN2; Sip24; SV-40-induced 24P3 protein; uterocalin |
| Gene | LCN2 |
| Product Type | Antibody |
| Gene ID (Entrez) | 16819, 170496 |
| Formulation | PBS with 4mg trehalose and 0.05mg sodium azide |
| Immunogen | E. coli-derived mouse Lipocalin 2 recombinant protein (Position: Q21-N200). |
| Classification | Polyclonal |
| Primary or Secondary | Primary |
Invitrogen™ Transthyretin Polyclonal Antibody
Greener Choice
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Rabbit Polyclonal Antibody
| Content And Storage | -20°C |
|---|---|
| Target Species | Mouse,Rat |
| Host Species | Rabbit |
| Conjugate | Unconjugated |
| Applications | Immunohistochemistry (Paraffin),Western Blot |
| Form | Lyophilized |
| Gene Accession No. | P02767, P07309 |
| Isotype | IgG |
| Concentration | 500 μg/mL |
| Antigen | Transthyretin |
| Gene Symbols | TTR |
| Regulatory Status | RUO |
| Purification Method | Antigen affinity chromatography |
| Gene Alias | AA408768; AI787086; Amyloidosis I; ATTR; carpal tunnel syndrome 1; CTS; CTS1; D17860; epididymis luminal protein 111; HEL111; HsT2651; Lr1; PALB; prealbumin; pre-albumin; prealbumin, amyloidosis type I; Tbpa; thyroxine-binding prealbumin; transthyretin; Tt; TTR |
| Gene | TTR |
| Product Type | Antibody |
| Gene ID (Entrez) | 22139, 24856 |
| Formulation | PBS with 5mg BSA and 0.05mg sodium azide |
| Immunogen | E.coli-derived rat Prealbumin recombinant protein (Position: G21-N147). |
| Classification | Polyclonal |
| Primary or Secondary | Primary |
Invitrogen™ ARL13B Recombinant Rabbit Monoclonal Antibody (HL2173)
Greener Choice
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Rabbit Recombinant Monoclonal Antibody
| Content And Storage | Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles. |
|---|---|
| Target Species | Human,Rat |
| Host Species | Rabbit |
| Conjugate | Unconjugated |
| Applications | Western Blot,Immunocytochemistry |
| Form | Liquid |
| Gene Accession No. | Q3SXY8 |
| Isotype | IgG |
| Concentration | 1 mg/mL |
| Antigen | ARL13B |
| Gene Symbols | ARL13B |
| Regulatory Status | RUO |
| Purification Method | Protein A |
| Gene Alias | A530097K21Rik; A930014M17Rik; ADP ribosylation factor like GTPase 13B; ADP-ribosylation factor like GTPase 13B; ADP-ribosylation factor-like 13B; ADP-ribosylation factor-like 2-like 1; ADP-ribosylation factor-like protein 13B; ADP-ribosylation factor-like protein 2-like 1; Arl13b; Arl2l1; ARL2-like protein 1; C530009C10Rik; hnn; JBTS8; Protein hennin |
| Gene | ARL13B |
| Product Type | Antibody |
| Gene ID (Entrez) | 200894, 304037 |
| Formulation | PBS with no preservative |
| Immunogen | Recombinant fragmemt of human ARL13B. |
| Classification | Recombinant Monoclonal |
| Primary or Secondary | Primary |
| Clone | HL2173 |
Invitrogen™ Aquaporin 1 Polyclonal Antibody
Greener Choice
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Rabbit Polyclonal Antibody
| Content And Storage | -20°C |
|---|---|
| Target Species | Human,Mouse,Rat |
| Host Species | Rabbit |
| Conjugate | Unconjugated |
| Applications | Flow Cytometry,Immunohistochemistry (Paraffin),Western Blot,Western Blot |
| Form | Lyophilized |
| Gene Accession No. | P29972, P29975, Q02013 |
| Isotype | IgG |
| Concentration | 500 μg/mL |
| Antigen | Aquaporin 1 |
| Gene Symbols | Aqp1 |
| Regulatory Status | RUO |
| Purification Method | Antigen affinity chromatography |
| Gene Alias | AQP 1; AQP CHIP; Aqp1; AQP-1; AQP-CHIP; aquaporin 1; Aquaporin 1 (aquaporin channel forming integral protein 28 (CHIP)); aquaporin 1 (channel-forming integral protein, 28kDa, CO blood group); aquaporin 1 (Colton blood group); aquaporin 1, Colton blood group antigen; Aquaporin CHIP; Aquaporin1; aquaporin-1; Aquaporin-CHIP; channel-like integral membrane protein, 28-kDa; CHIP 28; CHIP28; CO; Colton blood group; Delayed early response protein 2; DER2; growth factor-induced delayed early response protein; membrane channel; MGC26324; urine water channel; Water channel protein for red blood cells and kidney proximal tubule |
| Gene | Aqp1 |
| Product Type | Antibody |
| Gene ID (Entrez) | 11826, 25240, 358 |
| Formulation | PBS with 4mg trehalose and no preservative |
| Immunogen | A synthetic peptide corresponding to a sequence at the C-terminus of human Aquaporin 1 (240-269aa DRVKVWTSGQVEEYDLDADDINSRVEMKPK). |
| Classification | Polyclonal |
| Primary or Secondary | Primary |
Invitrogen™ c-MAF Monoclonal Antibody (sym0F1), Alexa Fluor™ 488, eBioscience™
Greener Choice
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Mouse Monoclonal Antibody
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
| Content And Storage | 4°C, store in dark, DO NOT FREEZE! |
|---|---|
| Target Species | Human,Mouse |
| Host Species | Mouse |
| Conjugate | Alexa Fluor 488 |
| Applications | Flow Cytometry |
| Form | Liquid |
| Gene Accession No. | O75444, P54843 |
| Isotype | IgG2b κ |
| Concentration | 0.5 mg/mL |
| Antigen | c-MAF |
| Gene Symbols | MAF |
| Regulatory Status | RUO |
| Purification Method | Affinity chromatography |
| Gene Alias | 2810401A20Rik; A230108G15Rik; Avian musculoaponeurotic fibrosarcoma (MAF) protooncogene; avian musculoaponeurotic fibrosarcoma (v-maf) AS42 oncogene homolog; AW047063; AYGRP; basic domain leucine zipper transcription factor; CCA4; cMaf; C-Maf; c-Maf long form; c-maf proto-oncogene; CTRCT21; fl13d12; hMafA; LOW QUALITY PROTEIN: transcription factor Maf; LOW QUALITY PROTEIN: transcription factor MafA; maf; MAF bZIP transcription factor; MAF bZIP transcription factor A; maf protein; Maf2; MAFA; Mafa homolog; MGC71685; pancreatic beta-cell-specific transcriptional activator; Proto-oncogene c-Maf; RGD1562627; RIPE3b1; RIPE3b1 factor; T lymphocyte c-maf long form; transcription factor Maf; Transcription factor Maf-2; transcription factor MafA; transcription factor RIPE3b1; v-maf avian musculoaponeurotic fibrosarcoma oncogene A; v-maf avian musculoaponeurotic fibrosarcoma oncogene homolog; v-maf avian musculoaponeurotic fibrosarcoma oncogene homolog A; v-maf avian musculoaponeurotic fibrosarcoma oncogene homolog a (paralog a); v-maf musculoaponeurotic fibrosarcoma oncogene family, protein A; v-maf musculoaponeurotic fibrosarcoma oncogene family, protein A (avian); v-maf musculoaponeurotic fibrosarcoma oncogene homolog; V-maf musculoaponeurotic fibrosarcoma oncogene homolog A; wu:fl13d12; Z-cmaf |
| Gene | MAF |
| Product Type | Antibody |
| Gene ID (Entrez) | 17132, 4094 |
| Formulation | PBS with 0.09% sodium azide; pH 7.2 |
| Immunogen | Full-length E. coli-produced c-Maf. |
| Classification | Monoclonal |
| Primary or Secondary | Primary |
| Clone | sym0F1 |
Invitrogen™ ISG15 Recombinant Rabbit Monoclonal Antibody (HL2017)
Greener Choice
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Rabbit Recombinant Monoclonal Antibody
| Content And Storage | Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles. |
|---|---|
| Target Species | Human,Mouse,Rat,Feline |
| Host Species | Rabbit |
| Conjugate | Unconjugated |
| Applications | Immunohistochemistry (Paraffin),Western Blot,Immunocytochemistry |
| Form | Liquid |
| Gene Accession No. | P05161, Q64339 |
| Isotype | IgG |
| Concentration | 1 mg/mL |
| Antigen | ISG15 |
| Gene Symbols | ISG15 |
| Regulatory Status | RUO |
| Purification Method | Protein A |
| Gene Alias | G1P2; hUCRP; IFI15; IGI15; IMD38; interferon, alpha-inducible protein; interferon, alpha-inducible protein (clone IFI-15K); interferon-induced 15 kDa protein; interferon-induced 15-KDa protein; interferon-induced 17 kDa protein; interferon-induced 17-kDa/15-kDa protein; interferon-stimulated protein (15 kDa); interferon-stimulated protein 15; interferon-stimulated protein, 15 kDa; IP17; Irfp; Isg15; ISG15 ubiquitin like modifier; ISG15 ubiquitin-like modifier; ubiquitin cross-reactive protein; Ubiquitin-like protein ISG15; UCRP |
| Gene | ISG15 |
| Product Type | Antibody |
| Gene ID (Entrez) | 100038882, 100174787, 298693, 9636 |
| Formulation | PBS with no preservative |
| Immunogen | Recombinant fragment of human ISG15. |
| Classification | Recombinant Monoclonal |
| Primary or Secondary | Primary |
| Clone | HL2017 |