
All Primary Antibodies
Primary antibodies, immunoglobulins that bind to specific proteins or other biomolecules, are used in many research applications and protocols to detect targets of interest. They are developed using different animal hosts, including mouse, rat, rabbit, goat, sheep, and many others.
Monoclonal and Polyclonal Antibodies
One type of primary antibodies, monoclonal antibodies, provides high reproducibility and low cross-reactivity and background noise. Another type, polyclonal antibodies, often costs less and provides greater affinity and quicker binding. Both are produced using plasma B cells, but the former uses the same clone and the latter uses different clones. Monoclonal antibodies require hybridoma cell lines, and polyclonal antibodies do not.
There are also recombinant monoclonal antibodies with similar benefits, like high affinity, scalability, and specificity. They are produced using in vitro cloning of plasma B cells and expression hosts.
Conjugated Primary Antibodies
Antibodies can be labeled with various fluorophores or detection agents or used without labels. Labeled primary antibodies, also known as conjugated primary antibodies, help researchers simplify and streamline their applications. They are coupled with common enzymes and dyes such as Alexa Fluor and often used in protein and cell analysis.
Applications
Antibodies for life sciences applications are used in flow cytometry, western blotting, ELISA, immunohistochemistry, and immunocytochemistry. Secondary antibodies can be added to support the detection and purification of certain antigens. They bind to the primary antibody, which binds to the antigen of interest. Finding the right combination of antibodies can result in greater antigen specificity and a strong, detectable signal.
- (1)
- (2)
- (1)
- (3,051)
- (867)
- (1,742)
- (4,057)
- (1)
- (3)
- (1)
- (1,046)
- (628)
- (586,994)
- (11,634)
- (1)
- (550)
- (58)
- (1)
- (6)
- (3,597)
- (2,515)
- (979)
- (211)
- (6)
- (3,879)
- (1,569)
- (1)
- (4)
- (7)
- (67)
- (5)
- (2,490)
- (3,677)
- (10,955)
- (1)
- (1)
- (4)
- (1)
- (239)
- (78)
- (8)
- (2,591)
- (344)
- (2)
- (7)
- (1)
- (136)
- (237)
- (1)
- (11)
- (97)
- (1)
- (157,820)
- (136,005)
- (1)
- (24)
- (3)
- (798)
- (2)
- (10,323)
- (1)
- (123)
- (1)
- (4)
- (11)
- (4)
- (18)
- (1)
- (2)
- (5)
- (34)
- (3)
- (1)
- (39)
- (1)
- (108)
- (1)
- (20)
- (11)
- (19)
- (6)
- (1)
- (10,976)
- (589)
- (1)
- (2)
- (9)
- (2)
- (2)
- (328)
- (360)
- (1)
- (5)
- (12,192)
- (2)
- (4,269)
- (1)
- (14)
- (7)
- (4,667)
- (3,989)
- (1)
- (19)
- (1)
- (1)
- (2)
- (17,464)
- (16,334)
- (27)
- (1)
- (2)
- (5,017)
- (1)
- (32)
- (3)
- (13)
- (77)
- (610)
- (17)
- (2)
- (1)
- (1)
- (1)
- (2,082)
- (1)
- (14)
- (3)
- (1)
- (1)
- (2)
- (7)
- (2)
- (2)
- (104)
- (1)
- (3,912)
- (2)
- (20)
- (5)
- (109)
- (1)
- (5)
- (1)
- (5)
- (200)
- (2)
- (8,810)
- (12)
- (2)
- (5)
- (9)
- (1)
- (24)
- (109)
- (6,330)
- (32,212)
- (1,381)
- (53)
- (1,545)
- (21)
- (7)
- (1)
- (2,153)
- (1)
- (4,384)
- (24)
- (2)
- (1)
- (1)
- (7)
- (38)
- (1)
- (1)
- (710)
- (1)
- (1)
- (3)
- (14)
- (3)
- (1)
- (1)
- (100)
- (105)
- (531,739)
- (5)
- (11)
- (537,986)
- (20,559)
- (60)
- (544)
- (3)
- (509)
- (2,364)
- (38)
- (1)
- (14)
- (1,414)
- (2)
- (2)
- (6)
- (4)
- (4)
- (28,308)
- (48)
- (149)
- (1,371)
- (12,678)
- (110)
- (7)
- (2)
- (385,550)
- (7)
- (1)
- (600,266)
- (43,888)
- (13,823)
- (171)
- (1)
- (1)
- (18,329)
- (9)
- (1)
- (20)
- (2,765)
- (74)
- (89)
- (275)
- (2)
- (52)
- (18,825)
- (18,580)
- (5)
- (19,826)
- (10)
- (18,549)
- (45)
- (93)
- (47)
- (18,884)
- (1)
- (19,656)
- (1)
- (3)
- (1)
- (70)
- (19,068)
- (18,854)
- (75)
- (69)
- (28)
- (75)
- (13)
- (123)
- (5)
- (103)
- (102)
- (2)
- (92)
- (1)
- (15)
- (5)
- (25,562)
- (10)
- (3)
- (223)
- (774)
- (1,030)
- (694)
- (754)
- (896)
- (860)
- (992)
- (841)
- (1,414)
- (883)
- (825)
- (1,039)
- (1,044)
- (1,037)
- (676)
- (1,048)
- (21,605)
- (127)
- (19)
- (65)
- (20)
- (1)
- (147)
- (1)
- (164)
- (1)
- (122)
- (19,368)
- (19,406)
- (19,806)
- (63)
- (19,390)
- (15,219)
- (1)
- (60)
- (19,324)
- (18,982)
- (18,962)
- (17)
- (9)
- (1)
- (1)
- (9)
- (5)
- (22,683)
- (5)
- (31)
- (1)
- (1)
- (338)
- (740)
- (20,181)
- (1)
- (22,343)
- (17,149)
- (17,684)
- (17,677)
- (17,146)
- (22,333)
- (38)
- (1)
- (5)
- (9)
- (12)
- (2)
- (103)
- (11)
- (22)
- (58)
- (28)
- (132)
- (171)
- (25)
- (90)
- (46)
- (54)
- (62)
- (9)
- (78)
- (84)
- (99)
- (88)
- (90)
- (50)
- (40)
- (12)
- (40)
- (50)
- (53)
- (109)
- (134)
- (41)
- (68)
- (65)
- (88)
- (60)
- (454)
- (19,563)
- (7)
- (4)
- (316)
- (309)
- (2,695)
- (3,522)
- (2)
- (3)
- (37)
- (209)
- (2,600)
- (94)
- (27)
- (17,647)
- (449)
- (532)
- (6)
- (12)
- (13)
- (5)
- (6)
- (1,230)
- (841)
- (172)
- (691)
- (50)
- (705)
- (727)
- (782)
- (715)
- (686)
- (46)
- (12)
- (29)
- (116)
- (6)
- (274)
- (250)
- (125)
- (126)
- (95)
- (46)
- (14)
- (5)
- (5)
- (9)
- (3)
- (10)
- (2)
- (64)
- (14)
- (433,811)
- (7)
- (188)
- (49)
- (2)
- (367)
- (68)
- (46)
- (25)
- (271)
- (3)
- (3)
- (4)
- (16,864)
- (16,895)
- (16,863)
- (36)
- (168)
- (240)
- (90)
- (4)
- (382)
- (89)
- (3)
- (1)
- (1,482)
- (1,004)
- (26)
- (3,666)
- (268)
- (346)
- (198)
- (6)
- (3)
- (13)
- (209)
- (49,255)
- (1)
- (93)
- (162)
- (121)
- (2,500)
- (2)
- (170)
- (306,406)
- (2,098)
- (2,004)
- (2,041)
- (50)
- (25)
- (120)
- (9)
- (258,677)
- (311)
- (7,870)
- (5)
- (6)
- (2)
- (4)
- (1)
- (4)
- (15)
- (12,459)
- (23)
- (1)
- (176)
- (167)
- (2,407)
- (67)
- (4)
- (2)
- (98)
- (15)
- (29)
- (36)
- (3,089)
- (2,007)
- (183,141)
- (59,193)
- (156)
- (58)
- (176,387)
- (305,707)
- (1)
- (77)
- (866)
- (27,831)
- (40)
- (12,813)
- (348,715)
- (19)
- (1)
- (85)
- (463)
- (80,608)
- (386)
- (11)
- (49)
- (270)
- (302)
- (457)
- (124)
- (1,033)
- (26)
- (5,076)
- (610)
- (3)
- (6)
- (129)
- (253)
- (9)
- (318)
- (1,063)
- (4)
- (6)
- (9,955)
- (1)
- (30)
- (13)
- (1,672)
- (42)
- (7,350)
- (2)
- (1)
- (303)
- (1)
- (85)
- (2)
- (1,281)
- (13)
- (3)
- (16)
- (1,638)
- (1,083)
- (800)
- (658)
- (2,573)
- (468)
- (87)
- (7)
- (4)
- (2,067)
- (185)
- (1)
- (1)
- (1)
- (680,909)
- (4)
- (1,362)
- (1)
- (18)
Filtered Search Results

SFRS9 Antibody - Azide and BSA Free, Novus Biologicals™
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More

Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Rabbit Polyclonal Antibody
Content And Storage | Store at -20°C. Avoid freeze-thaw cycles. |
---|---|
Target Species | Human |
Host Species | Rabbit |
Conjugate | Unconjugated |
Applications | Western Blot |
Form | Purified |
Isotype | IgG |
Antigen | SFRS9 |
Regulatory Status | RUO |
Purification Method | Affinity purified |
Dilution | Western Blot 1:500-1:2000 |
Gene Alias | Pre-mRNA-splicing factor SRp30C, serine/arginine-rich splicing factor 9, SFRS9, Splicing factor, arginine/serine-rich 9SR splicing factor 9, SRp30c |
Gene ID (Entrez) | 8683 |
Formulation | PBS (pH 7.3), 50% glycerol |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-221 of human SFRS9 (NP_003760.1). MSGWADERGGEGDGRIYVGNLPTDVREKDLEDLFYKYGRIREIELKNRHGLVPFAFVRFEDPRDAEDAIYGRNGYDYGQCRLRVEFPRTYGGRGGWPRGGRNGPPTRRSDFRVLVSGLPPSGSWQDLKDHMREAGDVCYADVQKDGVGMVEYLRKEDMEYALRKLDDTKFRSHEGETSYIRVYPERSTSYGYSRSRSGSRGRDSPYQSRGSPHYFSPFRPY |
Classification | Polyclonal |
Primary or Secondary | Primary |
NCKAP1 Antibody - Azide and BSA Free, Novus Biologicals™
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More

Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Rabbit Polyclonal Antibody
Content And Storage | Store at -20°C. Avoid freeze-thaw cycles. |
---|---|
Target Species | Human,Mouse,Rat |
Host Species | Rabbit |
Conjugate | Unconjugated |
Applications | Western Blot |
Form | Purified |
Isotype | IgG |
Research Discipline | Apoptosis |
Antigen | NCKAP1 |
Regulatory Status | RUO |
Purification Method | Affinity purified |
Dilution | Western Blot 1:500-1:2000 |
Gene Alias | FLJ11291, HEM2p125Nap1, KIAA0587, Membrane-associated protein HEM-2, MGC8981, NAP 1, NAP125, NAP1Nap1, NCK-associated protein 1 |
Gene ID (Entrez) | 10787 |
Formulation | PBS (pH 7.3), 50% glycerol |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-250 of human NCKAP1 (NP_038464.1). MSRSVLQPSQQKLAEKLTILNDRGVGMLTRLYNIKKACGDPKAKPSYLIDKNLESAVKFIVRKFPAVETRNNNQQLAQLQKEKSEILKNLALYYFTFVDVMEFKDHVCELLNTIDVCQVFFDITVNFDLTKNYLDLIITYTTLMILLSRIEERKAIIGLYNYAHEMTHGASDREYPRLGQMIVDYENPLKKMMEEFVPHSKSLSDALISLQMVYPRRNLSADQWRNAQLLSLISAPSTMLNPAQSDTMPC |
Classification | Polyclonal |
Primary or Secondary | Primary |
Calpastatin Mouse anti-Human, Clone: CAST/1550, Novus Biologicals™
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More

Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Mouse Monoclonal Antibody
Content And Storage | Store at 4°C. |
---|---|
Target Species | Human |
Host Species | Mouse |
Conjugate | Unconjugated |
Applications | ELISA,Immunohistochemistry (Paraffin) |
Form | Purified |
Isotype | IgG1 κ |
Research Discipline | Hypoxia, Neuroscience |
Concentration | 0.2 mg/mL |
Antigen | Calpastatin |
Regulatory Status | RUO |
Purification Method | Protein A or G purified |
Dilution | ELISA 2 to 4 μg/mL, Immunohistochemistry-Paraffin 1 to 2 μg/mL |
Gene Alias | BS-17, Calpain inhibitor, calpastatin, MGC9402, Sperm BS-17 component |
Gene ID (Entrez) | 831 |
Formulation | 10 mM PBS with 0.05% BSA |
Immunogen | Recombinant full-length human Calpastatin protein |
Classification | Monoclonal |
Primary or Secondary | Primary |
Clone | CAST/1550 |
BAP1 Mouse anti-Human, Clone: BAP1/2432, Novus Biologicals™
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More

Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Mouse Monoclonal Antibody
Content And Storage | Store at 4°C. |
---|---|
Target Species | Human |
Host Species | Mouse |
Conjugate | Unconjugated |
Applications | ELISA,Peptide Array |
Form | Purified |
Isotype | IgG2c κ |
Research Discipline | Apoptosis, Breast Cancer, Cancer, Cell Cycle and Replication, Chromatin Research, DNA Repair, Tumor Suppressors |
Concentration | 0.2 mg/mL |
Antigen | BAP1 |
Regulatory Status | RUO |
Purification Method | Protein A or G purified |
Dilution | ELISA, Protein Array |
Gene Alias | BRCA1 associated protein-1 (ubiquitin carboxy-terminal hydrolase), BRCA1-associated protein 1, Cerebral protein 6, cerebral protein-13, cerebral protein-6, DKFZp686N04275, EC 3.4.19.12, FLJ35406, FLJ37180, hucep-6, KIAA0272HUCEP-13, ubiquitin carboxyl-terminal hydrolase BAP1, ubiquitin carboxy-terminal hydrolase, UCHL2 |
Gene ID (Entrez) | 8314 |
Formulation | 10 mM PBS with 0.05% BSA |
Immunogen | Recombinant human BAP1 protein fragment (around aa 191-326) (exact sequence is proprietary) |
Classification | Monoclonal |
Primary or Secondary | Primary |
Clone | BAP1/2432 |
Filaggrin Mouse anti-Human, Clone: FLG/1945, Novus Biologicals™
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More

Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Mouse Monoclonal Antibody
Content And Storage | Store at 4°C. |
---|---|
Target Species | Human |
Host Species | Mouse |
Conjugate | Unconjugated |
Applications | ELISA,Peptide Array |
Form | Purified |
Isotype | IgG2b κ |
Research Discipline | Cell Biology, Cellular Markers |
Concentration | 0.2 mg/mL |
Antigen | Filaggrin |
Regulatory Status | RUO |
Purification Method | Protein A or G purified |
Dilution | Immunohistochemistry-Paraffin 1 to 2 μg/mL, Protein Array |
Gene Alias | ATOD2, epidermal filaggrin, filaggrin, Profilaggrin |
Gene ID (Entrez) | 2312 |
Formulation | 10 mM PBS with 0.05% BSA |
Immunogen | Recombinant human Filaggrin protein fragment (around aa 998-1104) (exact sequence is proprietary) |
Classification | Monoclonal |
Primary or Secondary | Primary |
Clone | FLG/1945 |
ZNF408 Mouse anti-Human, Clone: PCRP-ZNF408-1E5, Novus Biologicals™
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More

Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Mouse Monoclonal Antibody
Content And Storage | Store at 4°C. |
---|---|
Target Species | Human |
Host Species | Mouse |
Conjugate | Unconjugated |
Applications | Western Blot,Flow Cytometry,Peptide Array |
Form | Purified |
Isotype | IgG2b |
Concentration | 0.2 mg/mL |
Antigen | ZNF408 |
Regulatory Status | RUO |
Purification Method | Protein A or G purified |
Dilution | Western Blot 1 to 2 μg/mL, Flow Cytometry 1 to 2 μg/million cells, Protein Array |
Gene Alias | A8-51, C2-H2 type zinc finger protein, FLJ20216, HF.12, HZF3.1, KOX25zinc finger protein 3 (A8-51), PP838, Zfp113, zinc finger protein 3, Zinc finger protein HF.12, Zinc finger protein HZF3.1, Zinc finger protein KOX25 |
Gene ID (Entrez) | 79797 |
Formulation | 10 mM PBS with 0.05% BSA |
Immunogen | Recombinant full-length human ZNF408 protein |
Classification | Monoclonal |
Primary or Secondary | Primary |
Clone | PCRP-ZNF408-1E5 |
TFF2 Mouse anti-Human, Clone: GE16C, Novus Biologicals™
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More

Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Mouse Monoclonal Antibody
Content And Storage | Store at 4°C. |
---|---|
Target Species | Human |
Host Species | Mouse |
Conjugate | Unconjugated |
Applications | ELISA |
Form | Purified |
Isotype | IgM κ |
Concentration | 0.2 mg/mL |
Antigen | TFF2 |
Regulatory Status | RUO |
Purification Method | Protein L purified |
Dilution | ELISA |
Gene Alias | SML1trefoil factor 2, SML1, human spasmolytic polypeptide (SP)10spasmolytic protein 1, SP, spasmolysin, Spasmolytic polypeptide, trefoil factor 2 |
Gene ID (Entrez) | 7032 |
Formulation | 10 mM PBS with 0.05% BSA |
Immunogen | Synthetic peptide corresponding to a 16-amino acid C-terminal sequence of the human TFF2. |
Classification | Monoclonal |
Primary or Secondary | Primary |
Clone | GE16C |
PKC alpha Mouse anti-Human, Mouse, Rat, Clone: 133, Novus Biologicals™
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More

Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Mouse Monoclonal Antibody
Content And Storage | Store at 4°C. |
---|---|
Target Species | Human,Mouse,Rat |
Host Species | Mouse |
Conjugate | Unconjugated |
Applications | Western Blot,Immunohistochemistry (Paraffin) |
Form | Purified |
Isotype | IgG2a κ |
Research Discipline | Cancer, Cellular Markers, mTOR Pathway, Phospho Specific, Signal Transduction, Wnt Signaling Pathway |
Concentration | 0.2 mg/mL |
Antigen | PKC alpha |
Regulatory Status | RUO |
Purification Method | Protein A or G purified |
Dilution | Western Blot 1 to 2 μg/mL, Immunohistochemistry-Paraffin 1 to 2 μg/mL |
Gene Alias | AAG6, aging-associated gene 6, EC 2.7.11, EC 2.7.11.13, MGC129901, PKC-A, PKC-alpha, PKCAMGC129900, PRKACA, protein kinase C alpha type, protein kinase C, alpha |
Gene ID (Entrez) | 5578 |
Formulation | 10 mM PBS with 0.05% BSA |
Immunogen | Full-length protein corresponding to PKC alpha. Recognizes sequence PQFVHPILQSAV at the C terminus at PKC alpha |
Classification | Monoclonal |
Primary or Secondary | Primary |
Clone | 133 |
Herpes Simplex Virus 1 (HSV1) Rabbit anti-Virus, Polyclonal, Novus Biologicals™
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More

Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Rabbit Polyclonal Antibody
Content And Storage | Store at 4°C. |
---|---|
Target Species | Virus |
Host Species | Rabbit |
Conjugate | Unconjugated |
Applications | Immunohistochemistry (Paraffin) |
Form | Purified |
Isotype | IgG |
Concentration | 0.2 mg/mL |
Antigen | Herpes Simplex Virus 1 (HSV1) |
Regulatory Status | RUO |
Purification Method | Protein A purified |
Dilution | Immunohistochemistry-Paraffin 1 to 2 μg/mL |
Gene Alias | Herpes simplex virus 1, Herpes Simplex Virus 1 and 2, Herpes simplex virus 2, Herpes simplex virus type 1, Herpes simplex virus type 2, HSV 1, HSV 2 |
Formulation | 10 mM PBS with 0.05% BSA |
Immunogen | Detergent-solubilized herpes simplex virus (HSV) type 1 infected cells |
Classification | Polyclonal |
Primary or Secondary | Primary |
Nuclear Antigen Rabbit anti-Human, Mouse, Rat, Clone: NM2984R, Novus Biologicals™
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More

Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Rabbit Monoclonal Antibody
Content And Storage | Store at 4°C. |
---|---|
Target Species | Human,Mouse,Rat |
Host Species | Rabbit |
Conjugate | Unconjugated |
Applications | Immunohistochemistry (Paraffin) |
Form | Purified |
Isotype | IgG |
Concentration | 0.2 mg/mL |
Antigen | Nuclear Antigen |
Regulatory Status | RUO |
Purification Method | Protein A or G purified |
Dilution | Immunohistochemistry-Paraffin 0.25-0.5 μg/mL |
Formulation | 10 mM PBS with 0.05% BSA |
Immunogen | Nuclei of HL60 cells |
Classification | Monoclonal |
Primary or Secondary | Primary |
Clone | NM2984R |
S100A7/Psoriasin Antibody, Novus Biologicals™
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More

Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Rabbit Polyclonal Antibody
CEACAM3/CD66d Antibody - BSA Free, Novus Biologicals™
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More

Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Rabbit Polyclonal Antibody
Content And Storage | Store at -20°C. Avoid freeze-thaw cycles. |
---|---|
Target Species | Human,Mouse |
Host Species | Rabbit |
Conjugate | Unconjugated |
Applications | Western Blot |
Form | Purified |
Isotype | IgG |
Research Discipline | CD Markers, Immunology, Innate Immunity |
Antigen | CEACAM3/CD66d |
Regulatory Status | RUO |
Purification Method | Affinity purified |
Dilution | Western Blot 1:500-1:2000 |
Gene Alias | CD66D, CEA, CEACAM3 carcinoembryonic antigen-related cell adhesion molecule 3, CGM1, W264, W282 |
Gene ID (Entrez) | 1084 |
Formulation | PBS with 50% glycerol, pH7.3. |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-135 of human CEACAM3/CD66d (NP_001806.2). MGPPSASPHRECIPWQGLLLTASLLNFWNPPTTAKLTIESMPLSVAEGKEVLLLVHNLPQHLFGYSWYKGERVDGNSLIVGYVIGTQQATPGAAYSGRETIYTNASLLIQNVTQNDIGFYTLQVIKSDLVNEEAT |
Classification | Polyclonal |
Primary or Secondary | Primary |
CKMT2 Antibody - BSA Free, Novus Biologicals™
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More

Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Rabbit Polyclonal Antibody
Content And Storage | Store at -20°C. Avoid freeze-thaw cycles. |
---|---|
Target Species | Human,Mouse,Rat |
Host Species | Rabbit |
Conjugate | Unconjugated |
Applications | Western Blot |
Form | Purified |
Isotype | IgG |
Research Discipline | Cancer, Endocrinology, Signal Transduction |
Antigen | CKMT2 |
Regulatory Status | RUO |
Purification Method | Affinity purified |
Dilution | Western Blot 1:500-1:2000 |
Gene Alias | Basic-type mitochondrial creatine kinase, creatine kinase S-type, mitochondrial, creatine kinase, mitochondrial 2 (sarcomeric), EC 2.7.3, EC 2.7.3.2, mib-CK, Sarcomeric mitochondrial creatine kinase, S-MtCK, SMTCK |
Gene ID (Entrez) | 1160 |
Formulation | PBS with 50% glycerol, pH7.3. |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 40-230 of human CKMT2 (NP_001816.2). EVREQPRLFPPSADYPDLRKHNNCMAECLTPAIYAKLRNKVTPNGYTLDQCIQTGVDNPGHPFIKTVGMVAGDEESYEVFADLFDPVIKLRHNGYDPRVMKHTTDLDASKITQGQFDEHYVLSSRVRTGRSIRGLSLPPACTRAERREVENVAITALEGLKGDLAGRYYKLSEMTEQDQQRLIDDHFLFDK |
Classification | Polyclonal |
Primary or Secondary | Primary |
Cysteinyl Leukotriene R1/CysLTR1 Antibody - Azide and BSA Free, Novus Biologicals™
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More

Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Rabbit Polyclonal Antibody
Content And Storage | Store at -20°C. Avoid freeze-thaw cycles. |
---|---|
Target Species | Human,Mouse |
Host Species | Rabbit |
Conjugate | Unconjugated |
Applications | Western Blot |
Form | Purified |
Isotype | IgG |
Research Discipline | GPCR, Lipid and Metabolism |
Antigen | Cysteinyl Leukotriene R1/CysLTR1 |
Regulatory Status | RUO |
Purification Method | Affinity purified |
Dilution | Western Blot 1:500-1:2000 |
Gene Alias | CysLT(1), CYSLT1CysLT1, CYSLT1R, CYSLTR, CysLTR1, Cysteinyl leukotriene D4 receptor, cysteinyl leukotriene receptor 1, G-protein coupled receptor HG55, HG55, HMTMF81, LTD4 receptor, MGC46139 |
Gene ID (Entrez) | 10800 |
Formulation | PBS with 50% glycerol, pH7.3. |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human CYSLTR1 (NP_006630.1). MDETGNLTVSSATCHDTIDDFRNQVYSTLYSMISVVGFFGNGFVLYVLIKTYHKKSAFQVYMINLAVADLLCVCTLPLRVVYYVHKGIWLFGDFLCRLST |
Classification | Polyclonal |
Primary or Secondary | Primary |
CLVS2 Antibody - Azide and BSA Free, Novus Biologicals™
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More

Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Rabbit Polyclonal Antibody
Content And Storage | Store at -20°C. Avoid freeze-thaw cycles. |
---|---|
Target Species | Human |
Host Species | Rabbit |
Conjugate | Unconjugated |
Applications | Western Blot |
Form | Purified |
Isotype | IgG |
Research Discipline | Signal Transduction |
Antigen | CLVS2 |
Regulatory Status | RUO |
Purification Method | Affinity purified |
Dilution | Western Blot 1:500-1:2000 |
Gene Alias | bA160A10.4;C6orf212;C6orf213;Clavesin-2;RLBP1L2 |
Gene ID (Entrez) | 134829 |
Formulation | PBS with 50% glycerol, pH7.3. |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 265-327 of human CLVS2 (NP_001010852.2). LLDHEYDDDSEYNVDSYSMPVKEVEKELSPKSMKRSQSVVDPTVLKRMDKNEEENMQPLLSLD |
Classification | Polyclonal |
Primary or Secondary | Primary |