Protein Labeling Reagents
- (110)
- (20)
- (2)
- (7)
- (1)
- (38)
- (2)
- (1)
- (17)
- (7)
- (4)
- (15)
- (16)
- (8)
- (2)
- (1)
- (10)
- (5)
- (17)
- (1)
- (2)
- (16)
- (6)
- (6)
- (5)
- (15)
- (89)
- (20)
- (8)
- (66)
- (2)
- (2)
- (38)
- (4)
- (18)
- (3)
- (17)
- (5)
- (6)
- (1)
- (22)
- (2)
- (2)
- (2)
- (6)
- (6)
- (12)
- (27)
- (1)
- (2)
- (1)
- (11)
- (1)
- (4)
- (30)
- (1)
- (1)
- (2)
- (8)
- (6)
- (5)
- (5)
- (5)
- (5)
- (1)
- (6)
- (47)
- (2)
- (3)
- (3)
- (5)
- (5)
- (41)
- (44)
- (35)
Filtered Search Results
Lumiprobe BDP FL alkyne | 302795-84-2 | MFCD28400774 | 25 mg
BDP FL alkyne | Purity: 95% | Mol Wt: 329.15 | 302795-84-2 | MFCD28400774 | 25 mg
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
eMolecules Broadpharm / BDP 564/570 NHS ester / 1mg / 771351558 / BP-28883 / 95.000 / 150173-90-3 / [null] / 463.250 / C24H20BF2N3O4
Broadpharm / BDP 564/570 NHS ester / 1mg / 771351558 / BP-28883 / 95.000 / 150173-90-3 / [null] / 463.250 / C24H20BF2N3O4
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
eMolecules Broadpharm / Rhodamine Picolyl Azide / 1mg / 713699874 / BP-28123 / / / [null] / 816.820 / C36H32N8O11S2
Broadpharm / Rhodamine Picolyl Azide / 1mg / 713699874 / BP-28123 / / / [null] / 816.820 / C36H32N8O11S2
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
CPC Scientific TAMRA-Asp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val-OH (trifluoroacetate salt) 0.1MG
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
beta-Amyloid (1-40) found to exhibit both neurotrophic and neurotoxic effects that depend on neuronal age and beta-protein concentration.ONE-LETTER SEQUENCE: TAMRA-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVMOLECULAR FORMULA: C219H315N55O62S1MOLECULAR WEIGHT:4742.4STORAGE CONDITIONS: -20 5C, CAS REGISTRY NUMBER: [1802087-81-5], SYNONYMS: 5-TAMRA-Amyloid β-Protein (1-40)RESEARCH AREA: Alzheimer's DiseaseREFERENCES: B.A. Yankner et al., Science, 250, 279 (1990)
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
LUMIDYNE CORPORATION LD555-NHS 1000 NMOLS
NC3862429 LD555-NHS 1000 NMOLS
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
eMolecules Broadpharm / sulfo-Cy75 amine / 1mg / 761705805 / BP-28945 / / / [null] / 1143.490 / C51H60K2N4O13S4
Broadpharm / sulfo-Cy75 amine / 1mg / 761705805 / BP-28945 / / / [null] / 1143.490 / C51H60K2N4O13S4
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
eMolecules Broadpharm / Sulfo-Cy35 NHS ester / 1mg / 761705595 / BP-28888 / / 2231670-91-8 / [null] / 1088.320 / C42H40K3N3O16S4
Broadpharm / Sulfo-Cy35 NHS ester / 1mg / 761705595 / BP-28888 / / 2231670-91-8 / [null] / 1088.320 / C42H40K3N3O16S4
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
CPC Scientific FAM-Ser-Tyr-Ser-Met-Glu-His-Phe-Arg-Trp-Gly-Lys-Pro-Val-Gly-Lys-Lys-Arg-Arg-Pro-Val-Lys-Val-Tyr-Pro-OH (trifluoroacetate salt) 0.5MG
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Pituitary hormone N-terminal synthetic fragment that stimulates the corticosteroid synthesis and secretion in the adrenal cortex. This peptide is more active than ACTH in terms of corticosteroid releasing activity in vitro.ONE-LETTER SEQUENCE: Fam-SYSMEHFRWGKPVGKKRRPVKVYPMOLECULAR FORMULA: C157H220N40O37S1MOLECULAR WEIGHT:3291.8STORAGE CONDITIONS: -20 5C, CAS REGISTRY NUMBER: [16960-16-0], RESEARCH AREA: HormonalREFERENCES: Y.F.Jacquet, Science, 201, 1032 (1978)
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Revvity Health Sciences Inc IVISense Featured Probes Pack Fluorescent Imaging Panel
IVISense Featured Probes Pack Fluorescent Imaging Panel
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Cayman Chemical 17a 20-DIhydroxy-4-pregn-3 5mg
An endogenous, maturation-inducing steroid that at 1 UG/ml induces germinal vesicle breakdown in oocytes from several teleost species; can also influence spermiation by stimulating milt production when administered at 5 mg/kg to various male teleosts
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
eMolecules Broadpharm / Sulfo-Cy3 Azide / 1mg / 268505019 / BP-22482 / 90.000 / 1801695-56-6 / MFCD30527437 / 806.970 / C35H46N6O10S3
Broadpharm / Sulfo-Cy3 Azide / 1mg / 268505019 / BP-22482 / 90.000 / 1801695-56-6 / MFCD30527437 / 806.970 / C35H46N6O10S3
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Jackson Immuno Research Labs Fluorescein (FITC)-AffiniPure Rabbit Anti-Goat IgG Fc Fragment Specific
Fluorescein (FITC)-AffiniPure Rabbit Anti-Goat IgG Fc Fragment Specific
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Apexbio Technology LLC Sulfo-NHS-Biotin, 119616-38-5, MFCD00078535, 100 mg
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
MF: C14H18N3NaO8S2, MW: 443.4, Solubility: 22.17mg/mL in DMSO,insoluble in EtOH, 59.9 mg/mL in H2O with ultrasonic. Sulfo-NHS-Biotin (N-Hydroxysulfosuccinimidobiotin) is an amine-reactive biotinylation reagent.
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Lumiprobe Sulfo-Cyanine5 tetrazine, 1 mg
Sulfo-Cyanine5 tetrazine is a fluorophore derivative bearing a tetrazine group for the TCO-ligation based labeling. This reagent possesses good aqueous solubility and stability in biological environments.
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Cayman Chemical JWH 018 2-naphthyl Isomer 1mg
Differs structurally from JWH 018 by having the naphthyl group attached at the 2' position
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More