Protein Labeling Reagents
![Aat Bioquest 5-TAMRA, SE [5-Carboxytetramethylrhodamine, succinimidyl ester] *CAS#: 150810-68-7*](https://assets.fishersci.com/TFS-Assets/CCG/product-images/default.jpg-250.jpg)
Aat Bioquest 5-TAMRA, SE [5-Carboxytetramethylrhodamine, succinimidyl ester] *CAS#: 150810-68-7*
The single TAMRA isomers are increasingly preferred for labeling peptides and nucleotides because they give better resolution in HPLC purification that is often required in the conjugation processes.
Medchemexpress LLC HY-111377 5mg Medchemexpress, Amine-PEG3-Biotin CAS:359860-27-8 Purity:>98%
Medchemexpress, HY-111377 5mg Amine-PEG3-Biotin CAS:359860-27-8 Amine-PEG3-Biotin is used as a signal amplification label. Purity:>98% Medchemexpress has over 10000 novel life-science reagents, reference compounds, APIs and natural compounds for laboratory and scientific use. Other quantity can also be offered.
CPC Scientific TAMRA-Asp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val-OH (trifluoroacetate salt) 0.5MG
beta-Amyloid (1-40) found to exhibit both neurotrophic and neurotoxic effects that depend on neuronal age and beta-protein concentration.ONE-LETTER SEQUENCE: TAMRA-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVMOLECULAR FORMULA: C219H315N55O62S1MOLECULAR WEIGHT:4742.4STORAGE CONDITIONS: -20 5C, CAS REGISTRY NUMBER: [1802087-81-5], SYNONYMS: 5-TAMRA-Amyloid β-Protein (1-40)RESEARCH AREA: Alzheimer's DiseaseREFERENCES: B.A. Yankner et al., Science, 250, 279 (1990)
Medchemexpress LLC Cyanine5 NHS ester (iodide) | 00-00-0 | 98.0% | C36H42IN3O4 | 10MG
Cyanine5 NHS ester iodide is an amine-reactive, red-emitting fluorescent dye for covalent labeling of primary amino groups in peptides, proteins, and oligonucleotides. Supplied as a solid NHS-ester with an iodide counter-ion, it is characterized for research use with COA, SDS, HNMR, and LCMS documentation to support conjugation and analytical workflows.
- Red emission suitable for near-infrared fluorescence detection.
- Amine-reactive NHS ester for covalent labeling of primary amines.
- High purity supporting consistent conjugation performance.
- Available in multiple small-scale pack sizes for research use.
- Characterized by COA, HNMR, and LCMS documentation.
CPC Scientific 5FAM-Ser-Pro-Lys-Met-Val-Gln-Gly-Ser-Gly-Cys-Phe-Gly-Arg-Lys-Met-Asp-Arg-Ile-Ser-Ser-Ser-Ser-Gly-Leu-Gly-Cys-Lys-Val-Leu-Arg-Arg-His-OH (trifluoroacetate salt) 1MG
Brain natriuretic peptide or B-type natriuretic peptide (BNP) (also ventricular natriuretic peptide) is a 32-amino acid peptide secreted by heart ventricles in response to excessive stretching of heart muscle cells (cardiomyocytes).ONE-LETTER SEQUENCE: 5FAM-SPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH (Cys10 and 26 bridge)MOLECULAR FORMULA: C164H256N50O48S4MOLECULAR WEIGHT:3824.4STORAGE CONDITIONS: -20 5C, CAS REGISTRY NUMBER: [114471-18-0], RESEARCH AREA: CardiovascularREFERENCES: T. Sudoh et al., BBRC, 159, 1427 (1989)
CPC Scientific TAMRA-Asp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val-OH (trifluoroacetate salt) 0.1MG
beta-Amyloid (1-40) found to exhibit both neurotrophic and neurotoxic effects that depend on neuronal age and beta-protein concentration.ONE-LETTER SEQUENCE: TAMRA-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVMOLECULAR FORMULA: C219H315N55O62S1MOLECULAR WEIGHT:4742.4STORAGE CONDITIONS: -20 5C, CAS REGISTRY NUMBER: [1802087-81-5], SYNONYMS: 5-TAMRA-Amyloid β-Protein (1-40)RESEARCH AREA: Alzheimer's DiseaseREFERENCES: B.A. Yankner et al., Science, 250, 279 (1990)
Medchemexpress LLC HY-D0048 10mg Medchemexpress, 5-TAMRA-SE CAS:150810-68-7 Purity:>98%
Medchemexpress, HY-D0048 10mg 5-TAMRA-SE CAS:150810-68-7 0 Purity:>98% Medchemexpress has over 10000 novel life-science reagents, reference compounds, APIs and natural compounds for laboratory and scientific use. Other quantity can also be offered.
Biotium CF488A, Succinimidyl Ester
CF Dye Succinimidyl Esters (SE, also known as NHS esters) are amine-reactive fluorescent dyes. SE dyes are commonly used to label antibodies and other proteins on free amine groups, such as lysine residues. CF dyes are Biotium's line of next-generation fluorescent dyes with advantages in brightness, photostability, and conjugate specificity compared to other fluorescent dyes. Green fluorescent CF488A dye has excitation/emission at 490/515 nm.
STA PHARMACEUTICAL US LLC Fmoc-L-Lys(5-FAM)-OH | 25 g | CAS 1242933-88-5 | MDL MFCD03787910
Fmoc-L-Lys(5-FAM)-OH is a Amino Acid reagent (Subcategory: Lys) sold by WuXi TIDES. Offered in 25 g. Store at 4 °C. SDS available for reference.
Specifications
- CAS: 1242933-88-5
- MDL: MFCD03787910
- InChIKey: ZAGGWQSWIFPNCB-DHUJRADRSA-N
- Molecular Weight: 726.738
- Molecular Formula: C42H34N2O10
- Purity: ≥95%
- Container Type: 125 mL HDPE
- Pack Size: 25 g
- Net Weight: 25 g
- Gross Weight: 54.3 g
- Commodity Code: 29322090
- Country Of Origin: China
- IUPAC: N2-(((9H-fluoren-9-yl)methoxy)carbonyl)-N6-(3',6'-dihydroxy-3-oxo-3H-spiro[isobenzofuran-1,9'-xanthene]-5-carbonyl)-L-lysine
- SMILES: O=C(OCC1C2=C(C3=C1C=CC=C3)C=CC=C2)N[C@@H](CCCCNC(C4=CC5=C(C=C4)C6(C7=C(OC8=C6C=CC(O)=C8)C=C(O)C=C7)OC5=O)=O)C(O)=O
Medchemexpress LLC HY-D0723 10mg Medchemexpress, 5(6)-TAMRA SE CAS:246256-50-8 Purity:>98%
Medchemexpress, HY-D0723 10mg 5(6)-TAMRA SE CAS:246256-50-8 Purity:>98% Medchemexpress has over 10000 novel life-science reagents, reference compounds, APIs and natural compounds for laboratory and scientific use. Other quantity can also be offered.
Revvity Health Sciences Inc HTRF Anti-Europium NH2 Labeling Reagent, 1 mg
HTRF Anti-Europium NH2 Labeling Reagent, 1 mg
Sigma Aldrich Fine Chemicals Biosciences 6-Methylcoumarin >=99%, FCC, FG | 92-48-8 | MFCD00006875 |
6-Methylcoumarin >=99%, FCC, FG | Purity: >=99% | Mol Wt: 160.17 | 92-48-8 | MFCD00006875 |
STA PHARMACEUTICAL US LLC Fmoc-L-Lys(5-FAM)-OH | 100 g | CAS 1242933-88-5 | MDL MFCD03787910
Fmoc-L-Lys(5-FAM)-OH is a Amino Acid reagent (Subcategory: Lys) sold by WuXi TIDES. Offered in 100 g. Store at 4 °C. SDS available for reference.
Specifications
- CAS: 1242933-88-5
- MDL: MFCD03787910
- InChIKey: ZAGGWQSWIFPNCB-DHUJRADRSA-N
- Molecular Weight: 726.738
- Molecular Formula: C42H34N2O10
- Purity: ≥95%
- Container Type: 500 mL HDPE
- Pack Size: 100 g
- Net Weight: 100 g
- Gross Weight: 160.5 g
- Commodity Code: 29322090
- Country Of Origin: China
- IUPAC: N2-(((9H-fluoren-9-yl)methoxy)carbonyl)-N6-(3',6'-dihydroxy-3-oxo-3H-spiro[isobenzofuran-1,9'-xanthene]-5-carbonyl)-L-lysine
- SMILES: O=C(OCC1C2=C(C3=C1C=CC=C3)C=CC=C2)N[C@@H](CCCCNC(C4=CC5=C(C=C4)C6(C7=C(OC8=C6C=CC(O)=C8)C=C(O)C=C7)OC5=O)=O)C(O)=O
LICOR IRDye 680RD NHS Ester (50 mg)
IRDye infrared dyes from LI-COR Biosciences are available for researchers developing applications using near-infrared (NIR) fluorescence. These unique dyes are used in a variety of NIR imaging applications including Western blotting, plate-based assays, protein arrays, tissue section imaging, and molecular activity measurements. Standard NHS ester chemistry is used to produce custom probes labeled with LI-COR IRDye infrared dyes. The NHS ester reactive group provides the functionality for labeling primary and secondary amines, such as lysine residues in proteins.
Biotium S100B(4C4.9), CF488A conjugate, 0.1mg/mL
S100 belongs to the family of calcium binding proteins. S100A and S100B proteins are two members of the S100 family. S100A is composed of an alpha and a beta chain whereas S100B is composed of two beta chains. This antibody is specific against an epitope located on the beta-chain (i.e. in S-100A and S-100B) but not on the alpha-chain of S-100 (i.e. in S-100A and S100A0). This antibody can be used to localize S-100A and S-100B in various tissue sections. S-100 protein has been found in normal melanocytes, Langerhans cells, histiocytes, chondrocytes, lipocytes, skeletal and cardiac muscle, Schwann cells, epithelial and myoepithelial cells of the breast, salivary and sweat glands, as well as in glial cells. Neoplasms derived from these cells also express S-100 protein, albeit non-uniformly. A large number of well-differentiated tumors of the salivary gland, adipose and cartilaginous tissue, and Schwann cell-derived tumors express S-100 protein. Almost all malignant melanomas and