Protease Inhibitors and Phosphatase Inhibitors
MilliporeSigma™ Calbiochem™ InSolution™ Sirtinol
A cell-permeable 2-hydroxy-1-napthaldehyde derivative that acts as a specific and a direct inhibitor of sirtuin class of histone deacetylase (HDAC) activity
MilliporeSigma™ Calbiochem™ PCSK9 Inhibitor, EGF-A
A 42-mer synthetic peptide (GTNECLDNNGGCSHVCNDLKIGYECLCPDGFQLVAQRRCEDI-NH2) that contains a calcium binding site of EGF-A
MilliporeSigma™ Calbiochem™ Rho/SRF Pathway Inhibitor, CCG-1423
The Rho/SRF Pathway Inhibitor, CCG-1423, also referenced under CAS 285986-88-1, controls the biological activity of Rho/SRF. This small molecule/inhibitor is primarily used for Cell Structure applications.
MilliporeSigma™ Calbiochem™ PTP LYP Inhibitor
The PTP LYP Inhibitor controls the biological activity of PTP LYP. This small molecule/inhibitor is primarily used for Phosphorylation & Dephosphorylation applications.
MilliporeSigma™ Calbiochem™ Pristimerin
A cell-permeable plant dienone-phenolic triterpenoid, naturally isolated from tripterygium wilfordii.
MilliporeSigma™ Calbiochem™ Spermidine, Trihydrochloride
Polyamine that plays an important role in the regulation of cellular proliferation and differentiation.
MilliporeSigma™ Calbiochem™ PD 150606
A cell-permeable, non-competitive, selective non-peptide calpain inhibitor [Ki = 210 nM for calpain-1 and 370 nM for calpain-2.
MilliporeSigma™ Calbiochem™ RAD51-Stimulatory Compound-1, RS-1
A cell-permeable sulfonamido-benzamide-based allosteric regulator that stimulates DNA binding and recombinase activities of hRAD51 by locking hRAD51 in an active conformation without affecting its active site ATP hydrolysis.
MilliporeSigma™ Calbiochem™ D-Val-Phe-Lys Chloromethyl Ketone, Dihydrochloride
Selective irreversible inhibitor of plasmin with high selectivity for plasmin (IC50 = 100 pM for human plasmin) over urokinase.
MilliporeSigma™ Calbiochem™ α-Synuclein Blocker, ELN484228
A cell-permeable compound that reversibly binds to pocket I of the monomeric α-synuclein (α-syn) and reverses α-syn-induced impairment of phagocytosis in H4 neuroglioma cells.
MilliporeSigma™ Calbiochem™ InSolution™ K-252a, Nocardiopsis sp.
A cell-permeable protein kinase inhibitor that inhibits CaM kinase II (Ki = 1
MilliporeSigma™ Calbiochem™ eEF2K Inhibitor, A-484954
The eEF2K Inhibitor, A-484954, also referenced under CAS 142557-61-7, controls the biological activity of eEF2K Kinase. This small molecule/inhibitor is primarily used for Phosphorylation & Dephosphorylation applications.
MilliporeSigma™ Calbiochem™ Cdk7 Inhibitor VIII, THZ1
A cell-permeable, non-toxic, phenylaminopyrimidinyl-acrylamide compound that acts as a highly potent, selective, ATP-site directed, and irreversible inhibitor of Cdk7 (IC50
MilliporeSigma™ Calbiochem™ p75NTR Signaling Inhibitor, Cell-permeable, TAT-Pep5
The p75NTR Signaling Inhibitor, Cell-permeable, TAT-Pep5 controls the biological activity of p75NTR. This small molecule/inhibitor is primarily used for Neuroscience applications.
MilliporeSigma™ Calbiochem™ Tiagabine Hydrochloride
A potent uptake inhibitor highly selective for GABA Transport-1 (IC50 = 67nM in vivo