Recombinant Proteins
Filtered Search Results
Invitrogen™ Human GPR132 (aa 8-43) Control Fragment Recombinant Protein
Recombinant Protein
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
| Regulatory Status | RUO |
|---|---|
| Purity or Quality Grade | >80% by SDS-PAGE and Coomassie blue staining |
| Conjugate | Unconjugated |
| Form | Liquid |
| Formulation | 1 M urea, PBS with no preservative; pH 7.4 |
| Sequence | NGYNGNATPVTTTAPWASLGLSAKTCNNVSFEESRI |
| Concentration | ≥5.0 mg/mL |
| For Use With (Application) | Blocking Assay,Control |
| Name | Human GPR132 (aa 8-43) Control Fragment |
| Recombinant | Recombinant |
Invitrogen™ Human SERCA2 ATPase (aa 8-43) Control Fragment Recombinant Protein
Recombinant Protein
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
| Regulatory Status | RUO |
|---|---|
| Purity or Quality Grade | >80% by SDS-PAGE and Coomassie blue staining |
| Conjugate | Unconjugated |
| Form | Liquid |
| Formulation | 1 M urea, PBS with no preservative; pH 7.4 |
| Sequence | TVEEVLGHFGVNESTGLSLEQVKKLKERWGSNELPA |
| Concentration | ≥5.0 mg/mL |
| For Use With (Application) | Blocking Assay,Control |
| Name | Human SERCA2 ATPase (aa 8-43) Control Fragment |
| Recombinant | Recombinant |
Novus Biologicals™ Recombinant Human Exosome component 8 His Protein
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Highly purified. Generating reliable and reproducible results.
| Purity or Quality Grade | >90%, by SDS-PAGE under reducing conditions and visualized by Colloidal Coomassie™ Blue stain |
|---|---|
| Conjugate | Unconjugated |
| Gene Alias | bA421P11.3, CBP-interacting protein 3, CIP3, EAP2, exosome complex exonuclease RRP43, exosome component 8Opa-interacting protein 2, OIP2Ribosomal RNA-processing protein 43, Opa interacting protein 2, p9RP11-421P11.3, RRP43OIP-2, Rrp43p |
| Common Name | Exosome component 8 |
| Molecular Weight (g/mol) | TMW: 32.4kDa |
| Gene ID (Entrez) | 11340 |
| Formulation | 20mM Tris-HCl buffer (pH8.0) containing 50% glycerol 0.2M NaCl,1mM DTT |
| Storage Requirements | Store at 4°C short term. Aliquot and store at −20°C long term. Avoid freeze-thaw cycles. |
| Concentration | 0.25mg/mL |
| For Use With (Application) | SDS-PAGE |
| Recombinant | Recombinant |
Invitrogen™ Human EXOSC8 (aa 95-175) Control Fragment Recombinant Protein
Recombinant Protein
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
| Regulatory Status | RUO |
|---|---|
| Purity or Quality Grade | >80% by SDS-PAGE and Coomassie blue staining |
| Conjugate | Unconjugated |
| Form | Liquid |
| Formulation | 1 M urea, PBS with no preservative; pH 7.4 |
| Sequence | SGPPGEEAQVASQFIADVIENSQIIQKEDLCISPGKLVWVLYCDLICLDYDGNILDACTFALLAALKNVQLPEVTINEETA |
| Concentration | ≥5.0 mg/mL |
| For Use With (Application) | Blocking Assay,Control |
| Name | Human EXOSC8 (aa 95-175) Control Fragment |
| Recombinant | Recombinant |
Invitrogen™ Human EXOSC8 (aa 175-274) Control Fragment Recombinant Protein
Recombinant Protein
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
| Regulatory Status | RUO |
|---|---|
| Purity or Quality Grade | >80% by SDS-PAGE and Coomassie blue staining |
| Conjugate | Unconjugated |
| Form | Liquid |
| Formulation | 1 M urea, PBS with no preservative; pH 7.4 |
| Sequence | ALAEVNLKKKSYLNIRTHPVATSFAVFDDTLLIVDPTGEEEHLATGTLTIVMDEEGKLCCLHKPGGSGLTGAKLQDCMSRAVTRHKEVKKLMDEVIKSMK |
| Concentration | ≥5.0 mg/mL |
| For Use With (Application) | Blocking Assay,Control |
| Name | Human EXOSC8 (aa 175-274) Control Fragment |
| Recombinant | Recombinant |
Invitrogen™ Human EXOSC8 (aa 8-94) Control Fragment Recombinant Protein
Recombinant Protein
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
| Regulatory Status | RUO |
|---|---|
| Purity or Quality Grade | >80% by SDS-PAGE and Coomassie blue staining |
| Conjugate | Unconjugated |
| Form | Liquid |
| Formulation | 1 M urea, PBS with no preservative; pH 7.4 |
| Sequence | VEPLEYYRRFLKENCRPDGRELGEFRTTTVNIGSISTADGSALVKLGNTTVICGVKAEFAAPSTDAPDKGYVVPNVDLPPLCSSRFR |
| Concentration | ≥5.0 mg/mL |
| For Use With (Application) | Blocking Assay,Control |
| Name | Human EXOSC8 (aa 8-94) Control Fragment |
| Recombinant | Recombinant |
Invitrogen™ Human TAF8 (aa 156-224) Control Fragment Recombinant Protein
Recombinant Protein
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
| Regulatory Status | RUO |
|---|---|
| Purity or Quality Grade | >80% by SDS-PAGE and Coomassie blue staining |
| Conjugate | Unconjugated |
| Form | Liquid |
| Formulation | 1 M urea, PBS with no preservative; pH 7.4 |
| Sequence | PHTYIKTPTYREPVSDYQVLREKAASQRRDVERALTRFMAKTGETQSLFKDDVSTFPLIAARPFTIPYL |
| Concentration | ≥5.0 mg/mL |
| For Use With (Application) | Blocking Assay,Control |
| Name | Human TAF8 (aa 156-224) Control Fragment |
| Recombinant | Recombinant |
Invitrogen™ Human TAF8 (aa 18-79) Control Fragment Recombinant Protein
Recombinant Protein
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
| Regulatory Status | RUO |
|---|---|
| Purity or Quality Grade | >80% by SDS-PAGE and Coomassie blue staining |
| Conjugate | Unconjugated |
| Form | Liquid |
| Formulation | 1 M urea, PBS with no preservative; pH 7.4 |
| Sequence | GSKQSTNPADNYHLARRRTLQVVVSSLLTEAGFESAEKASVETLTEMLQSYISEIGRSAKSY |
| Concentration | ≥5.0 mg/mL |
| For Use With (Application) | Blocking Assay,Control |
| Name | Human TAF8 (aa 18-79) Control Fragment |
| Recombinant | Recombinant |
Invitrogen™ Human TAF8 (aa 85-154) Control Fragment Recombinant Protein
Recombinant Protein
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
| Regulatory Status | RUO |
|---|---|
| Purity or Quality Grade | >80% by SDS-PAGE and Coomassie blue staining |
| Conjugate | Unconjugated |
| Form | Liquid |
| Formulation | 1 M urea, PBS with no preservative; pH 7.4 |
| Sequence | RTQPTLSDIVVTLVEMGFNVDTLPAYAKRSQRMVITAPPVTNQPVTPKALTAGQNRPHPPHIPSHFPEFP |
| Concentration | ≥5.0 mg/mL |
| For Use With (Application) | Blocking Assay,Control |
| Name | Human TAF8 (aa 85-154) Control Fragment |
| Recombinant | Recombinant |
Invitrogen™ Human Chromogranin A (aa 22-162) Control Fragment Recombinant Protein
Recombinant Protein
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
| Regulatory Status | RUO |
|---|---|
| Purity or Quality Grade | >80% by SDS-PAGE and Coomassie blue staining |
| Conjugate | Unconjugated |
| Form | Liquid |
| Formulation | 1 M urea, PBS with no preservative; pH 7.4 |
| Sequence | NSPMNKGDTEVMKCIVEVISDTLSKPSPMPVSQECFETLRGDERILSILRHQNLLKELQDLALQGAKERAHQQKKHSGFEDELSEVLENQSSQAELKEAVEEPSSKDVMEKREDSKEAEKSGEATDGARPQALPEPMQESK |
| Concentration | ≥5.0 mg/mL |
| For Use With (Application) | Blocking Assay,Control |
| Name | Human Chromogranin A (aa 22-162) Control Fragment |
| Recombinant | Recombinant |
ACROBiosystems Human IL-8 / CXCL8 Protein, Fc Tag
Recombinant Protein;1MG;Human IL-8, Fc Tag (IL8-H5258) is expressed from human 293 cells (HEK293). It contains AA Ser 28 - Ser 99 (Accession # P10145-1).;This protein carries a human IgG1 Fc tag at the C-terminus. The protein has a calculated MW of 34.8 kDa. The protein migrates as 37-43 kDa under reducing (R) condition (SDS-PAGE) due to glycosylation.;Immobilized Human IL-8, Fc Tag (Cat. No. IL8-H5258) at 1 μg/mL (100 μL/well) can bind Monoclonal Anti-Human IL-8 Antibody, Human IgG1 with a linear range of 0.2-4 ng/mL (QC tested).
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
ACROBiosystems Human IL-8 / CXCL8 Protein, Fc Tag
Recombinant Protein;100UG;Human IL-8, Fc Tag (IL8-H5258) is expressed from human 293 cells (HEK293). It contains AA Ser 28 - Ser 99 (Accession # P10145-1).;This protein carries a human IgG1 Fc tag at the C-terminus. The protein has a calculated MW of 34.8 kDa. The protein migrates as 37-43 kDa under reducing (R) condition (SDS-PAGE) due to glycosylation.;Immobilized Human IL-8, Fc Tag (Cat. No. IL8-H5258) at 1 μg/mL (100 μL/well) can bind Monoclonal Anti-Human IL-8 Antibody, Human IgG1 with a linear range of 0.2-4 ng/mL (QC tested).
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Abcam Recombinant Human EXOSC8 protein, 50UG
Recombinant Human EXOSC8 protein is a Human Full Length protein, in the 1 to 276 aa range, expressed in Escherichia coli, with >90% purity and suitable for SDS-PAGE, MS.
Protein/ Peptide/ Enzyme Synonyms: OIP2, RRP43, EXOSC8, Exosome complex component RRP43, Exosome component 8, Opa-interacting protein 2, Ribosomal RNA-processing protein 43, p9, OIP-2
Conjugation: Unconjugated
The product is subject to the following: Abcam Restricted Use Statement
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
BioVendor, LLC Pregnant Mare Serum Gonadotropin (PMSG), 5,000 IU
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
TypeNative proteinDescriptionPMSG is a complex glycoprotein obtained from the serum of pregnant mares. This 43–63 kda protein is capable of supplementing and being substituted for the follicle stimulating gonadotrophin and interstitial cell-stimulating hormone of the anterior pituitary gland in both the male and female. Thus PMSG-Intervet stimulates development of the ovarian follicle in the female.SourceSerum of pregnant maresFormulationThe PMSG was lyophilized with no additives.ShippingAt ambient temperature. Upon receipt, store the product at the temperature recommended below.Storage/ExpirationLyophilized PMSG although stable at room temperature for 3 weeks, should be stored between 2–8°C.Physical AppearanceSterile filtered white lyophilized (freeze-dried) powder.
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
ACROBiosystems Recombinant Protein;Biotinylated Human B7-H4, ultra sensitivity (primary amine labeling);HEK293;200UG;B74,B7-H4,VTCN1,B7H4,B7S1,B7h.5,VTCN-1,B7-S1
Recombinant Protein;Biotinylated Human B7-H4, ultra sensitivity (primary amine labeling);200UG;MABSol Biotinylated Human B7-H4 (B74-H8222) is expressed from human HEK293 cells. It contains AA Phe 29 - Ala 258 (Accession # NP_078902). It is the biotinylated form of Human B7-H4 protein, His Tag (Cat. No. B74-H5222).;This protein carries a polyhistidine tag at the C-terminus. The protein has a calculated MW of 26.1 kDa. The protein migrates as 43-60 kDa under reducing (R) condition (SDS-PAGE) due to glycosylation.;Immobilized Anti-Human B7-H4 MAb at 2 g/mL (100 L/well) can bind Biotinylated Human B7-H4, His Tag (Cat. No. B74-H8222) with a linear range of 1-8 ng/mL (QC tested).
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More