Fluorobenzenes
- (1)
- (280)
- (1)
- (1)
- (28)
- (7)
- (6)
- (75)
- (22)
- (15)
- (1)
- (2)
- (1)
- (2)
- (1)
- (262)
- (1)
- (16)
- (3)
- (20)
- (56)
- (2)
- (400)
- (1)
- (7)
- (2)
- (18)
- (10)
- (5)
- (29)
- (9)
- (2)
- (3)
- (14)
- (9)
- (5)
- (20)
- (5)
- (19)
- (1)
- (4)
- (7)
- (5)
- (18)
- (6)
- (2)
- (4)
- (4)
- (8)
- (7)
- (32)
- (16)
- (2)
- (9)
- (5)
- (1)
- (8)
- (7)
- (1)
- (4)
- (4)
- (6)
- (8)
- (1)
- (1)
- (2)
- (2)
- (4)
- (2)
- (10)
- (17)
- (2)
- (24)
- (1)
- (2)
- (13)
- (2)
- (3)
- (4)
- (1)
- (3)
- (8)
- (3)
- (2)
- (7)
- (2)
- (11)
- (1)
- (2)
- (10)
- (1)
- (4)
- (1)
- (5)
- (2)
- (18)
- (6)
- (6)
- (20)
- (1)
- (4)
- (8)
- (2)
- (2)
- (1)
- (1)
- (8)
- (3)
- (1)
- (4)
- (1)
- (11)
- (18)
- (1)
- (1)
- (1)
- (2)
- (1)
- (1)
- (2)
- (1)
- (2)
- (5)
- (5)
- (6)
- (2)
- (1)
- (2)
- (3)
- (5)
- (2)
- (4)
- (2)
- (1)
- (5)
- (4)
- (1)
- (2)
- (2)
- (1)
- (14)
- (2)
- (3)
- (2)
- (3)
- (14)
- (15)
- (1)
- (4)
- (21)
- (9)
- (3)
- (1)
- (8)
- (5)
- (2)
- (1)
- (1)
- (2)
- (2)
- (4)
- (1)
- (3)
- (3)
- (1)
- (2)
- (4)
- (2)
- (1)
- (4)
- (5)
- (6)
- (3)
- (2)
- (1)
- (2)
- (1)
- (2)
- (4)
- (24)
- (1)
- (1)
- (2)
- (2)
- (4)
- (2)
- (19)
- (14)
- (4)
- (5)
- (1)
- (1)
- (1)
- (1)
- (2)
- (2)
- (1)
- (2)
- (8)
- (4)
- (1)
- (1)
- (2)
- (5)
- (1)
- (6)
- (1)
- (1)
- (1)
- (1)
- (2)
- (6)
- (1)
- (1)
- (5)
- (2)
- (1)
- (15)
- (14)
- (2)
- (8)
- (8)
- (2)
- (1)
- (3)
- (1)
- (1)
- (1)
- (1)
- (1)
- (3)
- (1)
- (4)
- (1)
- (2)
- (1)
- (2)
- (2)
- (2)
- (3)
- (3)
- (2)
- (4)
- (2)
- (2)
- (1)
- (1)
- (3)
- (2)
- (3)
- (1)
- (5)
- (1)
- (3)
- (1)
- (1)
- (7)
- (4)
- (1)
- (3)
- (5)
- (9)
- (2)
- (2)
- (2)
- (4)
- (2)
- (1)
- (2)
- (2)
- (1)
- (1)
- (2)
- (2)
- (10)
- (2)
- (3)
- (1)
- (7)
- (2)
- (5)
- (11)
- (3)
- (4)
- (2)
- (6)
- (4)
- (1)
- (1)
- (2)
- (1)
- (1)
- (1)
- (3)
- (2)
- (1)
- (1)
- (1)
- (16)
- (1)
- (2)
- (1)
- (2)
- (1)
- (1)
- (1)
- (2)
- (1)
- (1)
- (4)
- (1)
- (2)
- (2)
- (2)
- (4)
- (1)
- (1)
- (1)
- (2)
- (1)
- (2)
- (2)
- (3)
- (5)
- (7)
- (2)
- (1)
- (8)
- (2)
- (1)
- (1)
- (2)
- (1)
- (6)
- (1)
- (2)
- (1)
- (2)
- (2)
- (4)
- (2)
- (2)
- (1)
- (2)
- (2)
- (2)
- (4)
- (2)
- (2)
- (1)
- (1)
- (2)
- (1)
- (2)
- (1)
- (2)
- (5)
- (2)
- (5)
- (2)
- (2)
- (2)
- (4)
- (2)
- (8)
- (2)
- (1)
- (4)
- (16)
- (1)
- (2)
- (7)
- (2)
- (6)
- (46)
- (2)
- (5)
- (1)
- (1)
- (2)
- (4)
- (62)
- (250)
- (2)
- (40)
- (2)
- (4)
- (2)
- (5)
- (2)
- (15)
- (1)
- (2)
- (14)
- (1)
- (33)
- (2)
- (1)
- (1)
- (2)
- (28)
- (75)
- (151)
- (6)
- (216)
- (2)
- (144)
- (8)
- (1)
- (4)
- (22)
- (1)
- (242)
- (8)
- (2)
- (3)
- (6)
- (333)
- (2)
- (1)
- (3)
- (3)
- (3)
- (15)
- (3)
- (64)
- (2)
- (2)
- (1)
- (3)
- (2)
- (2)
- (1)
- (5)
- (1)
- (1)
- (2)
- (2)
- (2)
- (6)
- (2)
- (2)
- (2)
- (2)
- (3)
- (2)
- (2)
- (1)
- (3)
- (2)
- (1)
- (3)
- (7)
- (1)
- (2)
- (3)
- (2)
- (2)
- (2)
- (1)
- (2)
- (1)
- (2)
- (1)
- (1)
- (3)
- (2)
- (3)
- (3)
- (1)
- (5)
- (3)
- (5)
- (1)
- (1)
- (1)
- (3)
- (8)
- (2)
- (2)
- (2)
- (1)
- (2)
- (6)
- (5)
- (2)
- (2)
- (2)
- (2)
- (2)
- (2)
- (1)
- (2)
- (3)
- (2)
- (2)
- (1)
- (4)
- (2)
- (2)
- (6)
- (4)
- (3)
- (1)
- (3)
- (2)
- (3)
- (3)
- (2)
- (3)
- (8)
- (3)
- (3)
- (3)
- (2)
- (3)
- (5)
- (3)
- (3)
- (3)
- (4)
- (1)
- (2)
- (3)
- (3)
- (6)
- (2)
- (3)
- (3)
- (2)
- (6)
- (3)
- (3)
- (2)
- (3)
- (2)
- (1)
- (3)
- (2)
- (2)
- (2)
- (6)
- (3)
- (5)
- (5)
- (6)
- (3)
- (3)
- (4)
- (3)
- (9)
- (2)
- (2)
- (2)
- (2)
- (2)
- (4)
- (3)
- (2)
- (2)
- (2)
- (2)
- (1)
- (1)
- (2)
- (2)
- (2)
- (2)
- (1)
- (1)
- (3)
- (2)
- (2)
- (2)
- (3)
- (3)
- (2)
- (1)
- (5)
- (2)
- (2)
- (2)
- (2)
- (2)
- (2)
- (2)
- (2)
- (3)
- (3)
- (2)
- (2)
- (1)
- (2)
- (3)
- (1)
- (2)
- (2)
- (3)
- (4)
- (5)
- (2)
- (2)
- (2)
- (2)
- (2)
- (2)
- (1)
- (1)
- (2)
- (3)
- (1)
- (3)
- (1)
- (2)
- (2)
- (4)
- (2)
- (3)
- (2)
- (3)
- (5)
- (4)
- (3)
- (2)
- (3)
- (1)
- (3)
- (7)
- (3)
- (5)
- (7)
- (4)
- (2)
- (3)
- (1)
- (3)
- (2)
- (1)
- (2)
- (2)
- (3)
- (10)
- (1)
- (3)
- (1)
- (1)
- (2)
- (10)
- (2)
- (1)
- (2)
- (3)
- (4)
- (2)
- (1)
- (3)
- (6)
- (1)
- (2)
- (3)
- (2)
Filtered Search Results
Medchemexpress LLC (4-nh2)-exatecan | 2495742-21-5 | 99.9% | C23H21N3O4 | 10MG
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
(4-NH2)-Exatecan is a 4-amino derivative of the topoisomerase inhibitor exatecan supplied as a high-purity research reagent. It is intended for use as a cytotoxic payload or intermediate in the synthesis of antibody-drug conjugates (ADCs), and is provided with storage guidance for solid and solution states.
- Suitable as an antibody-drug conjugate (ADC) payload.
- Amino group at the 4-position enables linker conjugation.
- High purity appropriate for research applications.
- Available in small to mid-scale pack sizes for medicinal chemistry.
- Solid storage stability at 4°C when sealed and protected from moisture and light.
- For research use only; not for human or clinical use.
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
eMolecules 1261802-94-1 | Methyl 5-chloro-2,4-difluorobenzoate | ChemScene | MFCD18417407 | 206.570 | C8H5ClF2O2 | 98.000 | COC(=O)c1cc(Cl)c(F)cc1F | 1g | 632321477
Methyl 5-chloro-2,4-difluorobenzoate | ChemScene | 1261802-94-1 | MFCD18417407 | 206.570 | C8H5ClF2O2 | 98.000 | COC(=O)c1cc(Cl)c(F)cc1F | 1g | 632321477
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Medchemexpress LLC Mrgprx1 agonist 1 | 2377379-39-8 | C23H21N3O4S | 10MG
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
MRGPRX1 agonist 1 is a potent, selective small-molecule agonist of the Mas-related G protein-coupled receptor X1 (MRGPRX1). It has an EC50 of 50 nM and demonstrates >50-fold selectivity over δ, μ, and κ opioid receptors while showing no activity at MRGPRC11. It is used as a research reagent in studies of nociception and neuropathic pain signaling.
- Potent MRGPRX1 agonist (EC50 50 nM).
- Greater than 50-fold selectivity over delta, mu, and kappa opioid receptors.
- Inactive against MRGPRC11.
- Molecular formula C23H21N3O4S and molecular weight 435.50.
- Intended for research use in nociception and pain pathway studies.
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Selleck Chemical LLC AZD2461 5mg 1174043-16-3
AZD2461 is a novel PARP inhibitor with low affinity for Pgp than Olaparib. Phase 1. *For Research & Development use only. Product is not intended for drug, household, or human consumption.
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Selleck Chemical LLC Pitavastatin calcium S1759-200mg
Pitavastatin calcium a novel member of the medication class of statins is a calcium salt formulation of pitavastatin which is a highly effective HMG-CoA reductase inhibitor Pitavastatin Calcium attenuates AGEs-induced mitophagy via inhibition of ROS generation Pitavastatin Calcium induces autophagy and apoptosis
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
eMolecules 425-61-6 | 2,2,3,3-Tetrafluorobutane-1,4-diol | Apollo Scientific | MFCD00042375 | 162.084 | C4H6F4O2 | 98.000 | OCC(F)(F)C(F)(F)CO | 25g | 562449761
2,2,3,3-Tetrafluorobutane-1,4-diol | Apollo Scientific | 425-61-6 | MFCD00042375 | 162.084 | C4H6F4O2 | 98.000 | OCC(F)(F)C(F)(F)CO | 25g | 562449761
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Medchemexpress LLC Legumain inhibitor 1 | 2361157-34-6 | 98.3% | 100 MG
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Legumain inhibitor 1 is a potent and selective Legumain inhibitor with an IC50 of 3.6 nM. It is suitable for cancer research.
- Potent and selective Legumain inhibitor
- IC50 of 3.6 nM
- Suitable for cancer research
- Demonstrates high microsomal stability in vitro
- Half-lives exceeding 8 hours in mouse and human MICs
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Medchemexpress LLC Abemaciclib metabolite M20 | 2138499-06-4 | 95.9% | 10 MG
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Abemaciclib metabolite M20 (LSN3106726) is the active metabolite of Abemaciclib and functions as a selective CDK4/6 inhibitor for cancer treatment. This product is intended for research use only.
- Induces senescence in breast cancer cells
- Inhibits growth and cell cycle progression in non-small cell lung cancer (NSCLC) cells, colorectal cancer (CRC) cells, and breast cancer cells
- Effective as a CDK4 and CDK6 inhibitor with an IC50 value in the range of 1-3 nM
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Matrix Scientific 3,4,5-TRIFLUOROPHENYLBORONI-5G
3,4,5-Trifluorophenylboronic acid, 97%; 5g,C6H4BF3O2, MFCD02093069, mw 175.90, [143418-49-9]
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Medchemexpress LLC Stieeqaktfldkfnheaedlfyqsslaswn | 95.3% | 3649.88 | 10 MG
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
STIEEQAKTFLDKFNHEAEDLFYQSSLASWN is an angiotensin-converting enzyme 2 (ACE2) related peptide. It is used to study the function of ACE2 and has a molecular weight of 3649.88 with a chemical formula of C164H238N40O55. It appears as a white to off-white solid and is intended for research use only, not for human use.
- Angiotensin-converting enzyme 2 (ACE2) related peptide
- Used to study the function of ACE2
- Molecular weight of 3649.88
- White to off-white solid appearance
- For research use only
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Selleck Chemical LLC Darapladib
Darapladib is a reversible lipoprotein-associated phospholipase A2 (Lp-PLA2) inhibitor with IC50 of 0 25 nM Phase 3
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Medchemexpress LLC (Rac)-AZD 6482 | 663620-70-0 | 98.5% | C22H24N4O4 | 5 MG
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
(Rac)-AZD 6482 is the racemate of AZD 6482. It is a potent and selective p110β inhibitor, with an IC50 of 0.69 nM. This compound is intended for research use only.
- Potent and selective p110β inhibitor
- IC50 of 0.69 nM
- Racemate of AZD 6482
- Solid appearance
- White to light yellow color
- For research use only
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Medchemexpress LLC Retagliptin (SP2086) | 1174122-54-3 | 98.5% | 464.36 | 10 MG
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Retagliptin (SP2086) is a selective, competitive, and orally active dipeptidyl peptidase-4 (DPP-4) inhibitor. It is utilized for type 2 diabetes mellitus (T2DM) research by inhibiting the degradation of GLP-1, thereby amplifying the incretin effect.
- Selective, competitive, and orally active DPP-4 inhibitor.
- Used for type 2 diabetes mellitus (T2DM) research.
- Inhibits the degradation of GLP-1.
- Amplifies the incretin effect.
- Available as a solid.
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Medchemexpress LLC Hmbr 50Mg | HY-D1416-50MG
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Hmbr 50Mg
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
eMolecules 210532-25-5 | 3,5-Difluorobenzene-1-sulfonyl chloride | ChemScene | MFCD02091378 | 212.590 | C6H3ClF2O2S | 97.000 | Fc1cc(F)cc(c1)S(Cl)(=O)=O | 100g | 536851099
3,5-Difluorobenzene-1-sulfonyl chloride | ChemScene | 210532-25-5 | MFCD02091378 | 212.590 | C6H3ClF2O2S | 97.000 | Fc1cc(F)cc(c1)S(Cl)(=O)=O | 100g | 536851099
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More