Mass Spectrometers

Mass spectrometry is a technique that measures the mass-to-charge ratio of ions; used to quantify known materials, to identify unknown compounds within a sample, and to elucidate the structure and chemical properties of a variety of chemical species.

1 – 15 of 823 results

Scientific Cell Company Glass Filters for Testing Photometric Accuracy

For testing the photometric accuracy.

Pricing & Availability
Specifications

Includes	DAkkS calibration certificate
Type	Glass Filter

Scientific Cell Company Liquid Filter for Testing Photmetric Accuracy

For testing photometric accuracy (1.25 Abs) in the UV range.

Pricing & Availability

Scientific Cell Company Liquid Filter Set for Testing Photometric Accuracy in UV Range

For testing photometric accuracy (0.75 Abs) in the UV range, according to European Pharmacopoeia.

Pricing & Availability

Scientific Cell Company Liquid Filter Set For Testing Stray Light

Certified set for testing stray light.

Pricing & Availability
Specifications

Includes	UV10, UV12, DAkkS
Type	Liquid Filter Set
For Use With (Application)	Testing stray light

Invitrogen™ Human PKC delta (aa 8-150) Control Fragment Recombinant Protein

Recombinant Protein

Pricing & Availability
Specifications

Regulatory Status	RUO
Purity or Quality Grade	>80% by SDS-PAGE and Coomassie blue staining
Conjugate	Unconjugated
Form	Liquid
Formulation	1 M urea, PBS with no preservative; pH 7.4
Sequence	AFNSYELGSLQAEDEANQPFCAVKMKEALSTERGKTLVQKKPTMYPEWKSTFDAHIYEGRVIQIVLMRAAEEPVSEVTVGVSVLAERCKKNNGKAEFWLDLQPQAKVLMSVQYFLEDVDCKQSMRSEDEAKFPTMNRRGAIKQ
Concentration	≥5.0 mg/mL
For Use With (Application)	Blocking Assay,Control
Name	Human PKC delta (aa 8-150) Control Fragment
Recombinant	Recombinant