
Cell Culture Reagents, Antibiotics and Supplements
Products designed for cell culture processes including, but not limited to dissociation, decontamination, and growth stimulation.

Antibiotics
(6,492)

Cell Culture Growth Factors and Hormones
(2,276)

Additional Cell Culture Reagents and Supplements
(999)

Nutritional Supplements
(443)

Dissociation Reagents
(244)

Contaminant Detection and Removal Reagents
(54)

Growth Factor Products
(33)
Filtered Search Results
Products from some of our suppliers do not display in filtered search results. Please
clear all filters
to see these products.

1,066
–
1,080
of
9,701
results
Invitrogen™ Human LTV1 Homolog (aa 9-104) Control Fragment Recombinant Protein
Recombinant Protein

Encompass Procurement Services
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Regulatory Status | RUO |
---|---|
Purity or Quality Grade | >80% by SDS-PAGE and Coomassie blue staining |
Conjugate | Unconjugated |
Form | Liquid |
Formulation | 1 M urea, PBS with no preservative; pH 7.4 |
Sequence | FIEKKKAVSFHLVHRSQRDPLAADESAPQRVLLPTQKIDNEERRAEQRKYGVFFDDDYDYLQHLKEPSGPSELIPSSTFSAHNRREEKEETLVIPS |
Concentration | ≥5.0 mg/mL |
For Use With (Application) | Blocking Assay,Control |
Name | Human LTV1 Homolog (aa 9-104) Control Fragment |
Recombinant | Recombinant |
Invitrogen™ Human AMFR (aa 404-501) Control Fragment Recombinant Protein
Recombinant Protein

Encompass Procurement Services
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Regulatory Status | RUO |
---|---|
Purity or Quality Grade | >80% by SDS-PAGE and Coomassie blue staining |
Conjugate | Unconjugated |
Form | Liquid |
Formulation | 1 M urea, PBS with no preservative; pH 7.4 |
Sequence | VPVAAAEGRPRLNQHNHFFHFDGSRIASWLPSFSVEVMHTTNILGITQASNSQLNAMAHQIQEMFPQVPYHLVLQDLQLTRSVEITTDNILEGRIQVP |
Concentration | ≥5.0 mg/mL |
For Use With (Application) | Blocking Assay,Control |
Name | Human AMFR (aa 404-501) Control Fragment |
Recombinant | Recombinant |
Invitrogen™ Human KAO (aa 35-115) Control Fragment Recombinant Protein
Recombinant Protein

Encompass Procurement Services
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Regulatory Status | RUO |
---|---|
Purity or Quality Grade | >80% by SDS-PAGE and Coomassie blue staining |
Conjugate | Unconjugated |
Form | Liquid |
Formulation | 1 M urea, PBS with no preservative; pH 7.4 |
Sequence | DLSNQELKAVHSFLWSKKELRLQPSSTTTMAKNTVFLIEMLLPKKYHVLRFLDKGERHPVREARAVIFFGDQEHPNVTEFA |
Concentration | ≥5.0 mg/mL |
For Use With (Application) | Blocking Assay,Control |
Name | Human KAO (aa 35-115) Control Fragment |
Recombinant | Recombinant |
Invitrogen™ Human PTPRU (aa 28-111) Control Fragment Recombinant Protein
Recombinant Protein

Encompass Procurement Services
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Regulatory Status | RUO |
---|---|
Purity or Quality Grade | >80% by SDS-PAGE and Coomassie blue staining |
Conjugate | Unconjugated |
Form | Liquid |
Formulation | 1 M urea, PBS with no preservative; pH 7.4 |
Sequence | TFEEASDPAVPCEYSQAQYDDFQWEQVRIHPGTRAPADLPHGSYLMVNTSQHAPGQRAHVIFQSLSENDTHCVQFSYFLYSRDG |
Concentration | ≥5.0 mg/mL |
For Use With (Application) | Blocking Assay,Control |
Name | Human PTPRU (aa 28-111) Control Fragment |
Recombinant | Recombinant |
Invitrogen™ Human PPIL6 (aa 27-109) Control Fragment Recombinant Protein
Recombinant Protein

Encompass Procurement Services
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Regulatory Status | RUO |
---|---|
Purity or Quality Grade | >80% by SDS-PAGE and Coomassie blue staining |
Conjugate | Unconjugated |
Form | Liquid |
Formulation | 1 M urea, PBS with no preservative; pH 7.4 |
Sequence | KVVGLFSCPNFQIAKSAAENLKNNHPSKFEDPILVPLQEFAWHQYLQEKKRELKNETWEYSSSVISFVNGQFLGDALDLQKWA |
Concentration | ≥5.0 mg/mL |
For Use With (Application) | Blocking Assay,Control |
Name | Human PPIL6 (aa 27-109) Control Fragment |
Recombinant | Recombinant |
Invitrogen™ Human WEE2 (aa 305-396) Control Fragment Recombinant Protein
Recombinant Protein

Encompass Procurement Services
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Regulatory Status | RUO |
---|---|
Purity or Quality Grade | >80% by SDS-PAGE and Coomassie blue staining |
Conjugate | Unconjugated |
Form | Liquid |
Formulation | 1 M urea, PBS with no preservative; pH 7.4 |
Sequence | TKSGNHFEEPKLKDILLQISLGLNYIHNSSMVHLDIKPSNIFICHKMQSESSGVIEEVENEADWFLSANVMYKIGDLGHATSINKPKVEEGD |
Concentration | ≥5.0 mg/mL |
For Use With (Application) | Blocking Assay,Control |
Name | Human WEE2 (aa 305-396) Control Fragment |
Recombinant | Recombinant |
Invitrogen™ Human FOXP2 (aa 212-315) Control Fragment Recombinant Protein
Recombinant Protein

Encompass Procurement Services
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Regulatory Status | RUO |
---|---|
Purity or Quality Grade | >80% by SDS-PAGE and Coomassie blue staining |
Conjugate | Unconjugated |
Form | Liquid |
Formulation | 1 M urea, PBS with no preservative; pH 7.4 |
Sequence | AQQLVFQQQLLQMQQLQQQQHLLSLQRQGLISIPPGQAALPVQSLPQAGLSPAEIQQLWKEVTGVHSMEDNGIKHGGLDLTTNNSSSTTSSNTSKASPPITHHS |
Concentration | ≥5.0 mg/mL |
For Use With (Application) | Blocking Assay,Control |
Name | Human FOXP2 (aa 212-315) Control Fragment |
Recombinant | Recombinant |
Invitrogen™ Human eIF4H (aa 76-157) Control Fragment Recombinant Protein
Recombinant Protein

Encompass Procurement Services
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Regulatory Status | RUO |
---|---|
Purity or Quality Grade | >80% by SDS-PAGE and Coomassie blue staining |
Conjugate | Unconjugated |
Form | Liquid |
Formulation | 1 M urea, PBS with no preservative; pH 7.4 |
Sequence | KDTDKFKGFCYVEFDEVDSLKEALTYDGALLGDRSLRVDIAEGRKQDKGGFGFRKGGPDDRGMGSSRESRGGWDSRDDFNSG |
Concentration | ≥5.0 mg/mL |
For Use With (Application) | Blocking Assay,Control |
Name | Human eIF4H (aa 76-157) Control Fragment |
Recombinant | Recombinant |
Invitrogen™ Human BAD (aa 12-87) Control Fragment Recombinant Protein
Recombinant Protein

Encompass Procurement Services
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Regulatory Status | RUO |
---|---|
Purity or Quality Grade | >80% by SDS-PAGE and Coomassie blue staining |
Conjugate | Unconjugated |
Form | Liquid |
Formulation | 1 M urea, PBS with no preservative; pH 7.4 |
Sequence | QEDSSSAERGLGPSPAGDGPSGSGKHHRQAPGLLWDASHQQEQPTSSSHHGGAGAVEIRSRHSSYPAGTEDDEGMG |
Concentration | ≥5.0 mg/mL |
For Use With (Application) | Blocking Assay,Control |
Name | Human BAD (aa 12-87) Control Fragment |
Recombinant | Recombinant |
Invitrogen™ Human YES1 (aa 5-58) Control Fragment Recombinant Protein
Recombinant Protein

Encompass Procurement Services
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Regulatory Status | RUO |
---|---|
Purity or Quality Grade | >80% by SDS-PAGE and Coomassie blue staining |
Conjugate | Unconjugated |
Form | Liquid |
Formulation | 1 M urea, PBS with no preservative; pH 7.4 |
Sequence | KSKENKSPAIKYRPENTPEPVSTSVSHYGAEPTTVSPCPSSSAKGTAVNFSSLS |
Concentration | ≥5.0 mg/mL |
For Use With (Application) | Blocking Assay,Control |
Name | Human YES1 (aa 5-58) Control Fragment |
Recombinant | Recombinant |
Invitrogen™ Human Caspr2 (aa 1001-1142) Control Fragment Recombinant Protein
Recombinant Protein

Encompass Procurement Services
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Regulatory Status | RUO |
---|---|
Purity or Quality Grade | >80% by SDS-PAGE and Coomassie blue staining |
Conjugate | Unconjugated |
Form | Liquid |
Formulation | 1 M urea, PBS with no preservative; pH 7.4 |
Sequence | CNKDVGAFFEEGMWLRYNFQAPATNARDSSSRVDNAPDQQNSHPDLAQEEIRFSFSTTKAPCILLYISSFTTDFLAVLVKPTGSLQIRYNLGGTREPYNIDVDHRNMANGQPHSVNITRHEKTIFLKLDHYPSVSYHLPSSS |
Concentration | ≥5.0 mg/mL |
For Use With (Application) | Blocking Assay,Control |
Name | Human Caspr2 (aa 1001-1142) Control Fragment |
Recombinant | Recombinant |
Invitrogen™ Human LAGE3 (aa 2-51) Control Fragment Recombinant Protein
Recombinant Protein

Encompass Procurement Services
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Regulatory Status | RUO |
---|---|
Purity or Quality Grade | >80% by SDS-PAGE and Coomassie blue staining |
Conjugate | Unconjugated |
Form | Liquid |
Formulation | 1 M urea, PBS with no preservative; pH 7.4 |
Sequence | RDADADAGGGADGGDGRGGHSCRGGVDTAAAPAGGAPPAHAPGPGRDAAS |
Concentration | ≥5.0 mg/mL |
For Use With (Application) | Blocking Assay,Control |
Name | Human LAGE3 (aa 2-51) Control Fragment |
Recombinant | Recombinant |
Invitrogen™ Human CD41 (aa 639-715) Control Fragment Recombinant Protein
Recombinant Protein

Encompass Procurement Services
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Regulatory Status | RUO |
---|---|
Purity or Quality Grade | >80% by SDS-PAGE and Coomassie blue staining |
Conjugate | Unconjugated |
Form | Liquid |
Formulation | 1 M urea, PBS with no preservative; pH 7.4 |
Sequence | CVPQLQLTASVTGSPLLVGADNVLELQMDAANEGEGAYEAELAVHLPQGAHYMRALSNVEGFERLICNQKKENETRV |
Concentration | ≥5.0 mg/mL |
For Use With (Application) | Blocking Assay,Control |
Name | Human CD41 (aa 639-715) Control Fragment |
Recombinant | Recombinant |
Invitrogen™ Human NAP1L6 (aa 1-76) Control Fragment Recombinant Protein
Recombinant Protein

Encompass Procurement Services
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Regulatory Status | RUO |
---|---|
Purity or Quality Grade | >80% by SDS-PAGE and Coomassie blue staining |
Conjugate | Unconjugated |
Form | Liquid |
Formulation | 1 M urea, PBS with no preservative; pH 7.4 |
Sequence | MMEGLGEHSTAGEMGPLLGAVAATASPQSLMEYSSDADFIESLPLVVKYRVYTLKKLQAKCAVLEAKYLREFHSVE |
Concentration | ≥5.0 mg/mL |
For Use With (Application) | Blocking Assay,Control |
Name | Human NAP1L6 (aa 1-76) Control Fragment |
Recombinant | Recombinant |
Invitrogen™ Human MOK (aa 328-401) Control Fragment Recombinant Protein
Recombinant Protein

Encompass Procurement Services
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Regulatory Status | RUO |
---|---|
Purity or Quality Grade | >80% by SDS-PAGE and Coomassie blue staining |
Conjugate | Unconjugated |
Form | Liquid |
Formulation | 1 M urea, PBS with no preservative; pH 7.4 |
Sequence | KQSLKQEEDRPKRRGPAYVMELPKLKLSGVVRLSSYSSPTLQSVLGSGTNGRVPVLRPLKCIPASKKTDPQKDL |
Concentration | ≥5.0 mg/mL |
For Use With (Application) | Blocking Assay,Control |
Name | Human MOK (aa 328-401) Control Fragment |
Recombinant | Recombinant |