Antibiotics
- (3)
- (1)
- (1)
- (166)
- (26)
- (31)
- (6)
- (18)
- (1)
- (1)
- (36)
- (1)
- (8)
- (5)
- (28)
- (1)
- (2)
- (1)
- (1)
- (4)
- (1)
- (72)
- (10)
- (3)
- (44)
- (2)
- (1)
- (1)
- (2)
- (3)
- (4)
- (5)
- (1)
- (1)
- (2)
- (138)
- (7)
- (13)
- (4)
- (23)
- (5)
- (1)
- (27)
- (174)
- (6)
- (1)
- (23)
- (22)
- (1)
- (9)
- (1)
- (23)
- (1)
- (19)
- (1)
- (29)
- (1)
- (1)
- (24)
- (1)
- (2)
- (1)
- (144)
- (1)
- (2)
- (1)
- (5)
- (1)
- (2)
- (2)
- (13)
- (3)
- (1)
- (4)
- (5)
- (1)
- (4)
- (2)
- (17)
- (1)
- (4)
- (7)
- (1)
- (3)
- (2)
- (4)
- (1)
- (2)
- (5)
- (1)
- (2)
- (5)
- (6)
- (2)
- (3)
- (1)
- (2)
- (1)
- (9)
- (3)
- (2)
- (2)
- (3)
- (3)
- (12)
- (2)
- (2)
- (2)
- (7)
- (3)
- (2)
- (2)
- (1)
- (2)
- (4)
- (6)
- (2)
- (2)
- (1)
- (1)
- (2)
- (1)
- (1)
- (1)
- (3)
- (5)
- (2)
- (1)
- (2)
- (2)
- (2)
- (1)
- (4)
- (2)
- (2)
- (5)
- (4)
- (2)
- (2)
- (1)
- (5)
- (7)
- (3)
- (2)
- (3)
- (1)
- (2)
- (2)
- (2)
- (3)
- (3)
- (2)
- (2)
- (3)
- (2)
- (1)
- (3)
- (2)
- (2)
- (3)
- (2)
- (1)
- (2)
- (4)
- (4)
- (2)
- (1)
- (3)
- (2)
- (1)
- (5)
- (9)
- (2)
- (1)
- (3)
- (4)
- (7)
- (1)
- (1)
- (2)
- (1)
- (1)
- (2)
- (3)
- (2)
- (1)
- (2)
- (7)
- (6)
- (3)
- (3)
- (2)
- (16)
- (1)
- (2)
- (2)
- (2)
- (2)
- (11)
- (1)
- (4)
- (3)
- (3)
- (2)
- (1)
- (4)
- (1)
- (11)
- (7)
- (2)
- (3)
- (1)
- (1)
- (2)
- (7)
- (2)
- (1)
- (1)
- (3)
- (2)
- (2)
- (4)
- (1)
- (1)
- (2)
- (3)
- (2)
- (2)
- (2)
- (3)
- (2)
- (1)
- (2)
- (2)
- (5)
- (1)
- (3)
- (4)
- (5)
- (6)
- (5)
- (4)
- (2)
- (1)
- (2)
- (5)
- (2)
- (4)
- (9)
- (9)
- (7)
- (4)
- (3)
- (1)
- (1)
- (2)
- (2)
- (1)
- (2)
- (2)
- (8)
- (1)
- (8)
- (2)
- (14)
- (3)
- (8)
- (1)
- (14)
- (2)
- (2)
- (3)
- (2)
- (4)
- (7)
- (3)
- (2)
- (3)
- (2)
- (3)
- (2)
- (17)
- (4)
- (1)
- (3)
- (2)
- (6)
- (2)
- (1)
- (1)
- (3)
- (6)
- (3)
- (2)
- (1)
- (1)
- (8)
- (4)
- (3)
- (6)
- (3)
- (5)
- (6)
- (1)
- (7)
- (9)
- (2)
- (1)
- (1)
- (11)
- (186)
- (10)
- (9)
- (4)
- (7)
- (111)
- (10)
- (1)
- (1)
- (507)
- (2)
- (17)
- (52)
- (3)
- (1)
- (3)
- (3)
- (3)
- (7)
- (1)
- (1)
- (9)
- (4)
- (3)
- (13)
- (5)
- (2)
- (17)
- (8)
- (2)
- (4)
- (1)
- (1)
- (1)
- (1)
- (4)
- (1)
- (1)
- (2)
- (6)
- (5)
- (2)
- (8)
- (2)
- (1)
- (1)
- (3)
- (2)
- (2)
- (2)
- (1)
- (2)
- (2)
- (3)
- (2)
- (2)
- (2)
- (2)
- (7)
- (4)
- (1)
- (3)
- (6)
- (5)
- (1)
- (6)
- (2)
- (2)
- (3)
- (2)
- (3)
- (1)
- (1)
- (4)
- (5)
- (3)
- (8)
- (1)
- (2)
- (1)
- (5)
- (3)
- (2)
- (2)
- (1)
- (10)
- (2)
- (2)
- (7)
- (1)
- (2)
- (4)
- (7)
- (2)
- (5)
- (5)
- (2)
- (2)
- (2)
- (1)
- (5)
- (3)
- (2)
- (3)
- (3)
- (1)
- (1)
- (5)
- (4)
- (4)
- (1)
- (3)
- (4)
- (3)
- (2)
- (5)
- (1)
- (3)
- (2)
- (4)
- (3)
- (2)
- (4)
- (2)
- (2)
- (13)
- (3)
- (2)
- (1)
- (1)
- (2)
- (5)
- (3)
- (7)
- (6)
- (2)
- (4)
- (1)
- (2)
- (3)
- (9)
- (2)
- (7)
- (2)
- (2)
- (1)
- (5)
- (9)
- (1)
- (2)
- (4)
- (7)
- (4)
- (7)
- (5)
- (10)
- (2)
- (2)
- (3)
- (10)
- (1)
- (2)
- (4)
- (1)
- (2)
- (3)
- (1)
- (2)
- (5)
- (1)
- (3)
- (11)
- (1)
- (3)
- (2)
- (10)
- (5)
- (1)
- (13)
- (1)
- (2)
- (2)
- (1)
- (1)
- (4)
- (1)
- (3)
- (1)
- (2)
- (3)
- (2)
- (8)
- (2)
- (1)
- (2)
- (1)
- (20)
- (1)
- (4)
- (2)
- (1)
- (4)
- (1)
- (2)
- (2)
- (2)
- (3)
- (9)
- (2)
- (5)
- (3)
- (4)
- (1)
- (13)
- (11)
- (1)
- (3)
- (12)
- (7)
- (2)
- (2)
- (14)
- (3)
- (3)
- (3)
- (3)
- (4)
- (1)
- (5)
- (2)
- (1)
- (16)
- (1)
- (2)
- (2)
- (1)
- (2)
- (7)
- (1)
- (2)
- (17)
- (7)
- (2)
- (8)
- (2)
- (3)
- (3)
- (2)
- (10)
- (5)
- (8)
- (5)
- (3)
- (1)
- (7)
- (2)
- (4)
- (2)
- (12)
- (2)
- (8)
- (5)
- (3)
- (9)
- (3)
- (6)
- (1)
- (4)
- (3)
- (399)
- (15)
- (2)
- (34)
- (19)
- (54)
- (28)
- (76)
Filtered Search Results
Apexbio Technology LLC Cetylpyridinium Chloride 123-03-5 50mg
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Cetylpyridinium chloride (CAS 123-03-5) is a small-molecule inhibitor targeting microbial cell membranes It is designed to disrupt bacterial lipid bilayers thereby altering membrane permeability and inhibiting microbial viability Cetylpyridinium chloride exerts its biological activity primarily through membrane destabilization via positively charged cetylpyridinium ions interacting with negatively charged microbial surfaces In in vitro studies cetylpyridinium chloride demonstrates inhibitory activity with IC50 values ranging approximately between 0 5 to 10 M depending on microbial strain type and experimental conditions Based on these pharmacological properties cetylpyridinium chloride holds research potential in evaluating oral microbial inhibition biofilm formation interference and cell membrane-targeted antibacterial strategies
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
eMolecules 2098546-05-3 | Medchem Express | EBI-2511 | 5mg | 441681833 | HY-111418 | 576.782 | C34H48N4O4
Ambeed | Sodium 23-dimercapto-1-propanesulfonate | 1g | 598442112 | A203975 | 4076-02-2 | MFCD00007523 | 210.260 | C3H7NaO3S3
If you are unable to find the chemical you are looking for, make sure you are logged into your fishersci.com account and click on the following link:
eMolecules Building Block Tool<|a>
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
U.S. Pharmacopeia CHLOTETRACYCLINE HYDROCHLORIDE
Chlortetracycline Hydrochloride (200 mg)
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Medchemexpress LLC HY-100888 50mg Medchemexpress, Simurosertib CAS:1330782-76-7 Purity:>98%
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Medchemexpress, HY-100888 50mg Simurosertib CAS:1330782-76-7 Simurosertib (TAK-931) is a selective cycle 7 (CDC7) kinase inhibitor, with an IC 50 <0.3 nM. Purity:>98% Medchemexpress has over 10000 novel life-science reagents, reference compounds, APIs and natural compounds for laboratory and scientific use. Other quantity can also be offered.
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
![eMolecules 129319-91-1 | (2R)-tert-Butyl 2-methylaziridine-1-carboxylate | Synthonix - Stock | MFCD28098437 | 157.213 | C8H15NO2 | 97.000 | C[C@@H]1CN1C(=O)OC(C)(C)C | 500mg | 525932204](https://assets.fishersci.com/TFS-Assets/CCG/product-images/502167908.JPG-250.jpg)
eMolecules 129319-91-1 | (2R)-tert-Butyl 2-methylaziridine-1-carboxylate | Synthonix - Stock | MFCD28098437 | 157.213 | C8H15NO2 | 97.000 | C[C@@H]1CN1C(=O)OC(C)(C)C | 500mg | 525932204
(2R)-tert-Butyl 2-methylaziridine-1-carboxylate | Synthonix - Stock | 129319-91-1 | MFCD28098437 | 157.213 | C8H15NO2 | 97.000 | C[C@@H]1CN1C(=O)OC(C)(C)C | 500mg | 525932204
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Apexbio Technology LLC Etifoxine hydrochloride 56776-32-0 10mg
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Etifoxine hydrochloride (CAS 56776-32-0) is a small molecule that modulates GABAA receptor activity with selectivity towards receptors containing 2 or 3 subunits In neuronal cell culture models it enhances GABAA receptor-mediated responses Etifoxine also binds to the translocator protein (TSPO) a mitochondrial protein involved in neurosteroidogenesis In preclinical and clinical studies etifoxine demonstrates anxiolytic effects without producing sedative muscle relaxant or cognitive impairment typically associated with benzodiazepines Additionally it has been reported to promote axonal regeneration supporting its utility in neuropharmacological and neuroregeneration research
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Cayman Chemical RoxIthromycIn 10g
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
A macrolide antibiotic; active against five strains EAch of Staphylococcus and Streptococcus (geometric mean MICs = 0.08 and 0.79 UG/ml, respectively), as well as several strains EAch of Corynebacterium, Haemophilus, and S. pneumoniae (MIC50s = 0.02, 0.01, and 2.5 UG/ml, respectively); protective against infection by strains of S. aureus, S. pyogenes, S. pneumoniae, or L. monocytogenes in mice (PD50s = 23-98 mg/kg)
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
CPC Scientific H-Ala-Val-Ser-Glu-His-Gln-Leu-Leu-His-Asp-Lys-Gly-Lys-Ser-Ile-Gln-Asp-Leu-Arg-Arg-Arg-Phe-Phe-Leu-His-His-Leu-Ile-Ala-Glu-Ile-His-Thr-Ala-OH (trifluoroacetate salt) 0.5MG
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Peptide found to have anabolic effect on bone formation in rats that can inhibit the rapid decline in bone formation due to denervation.ONE-LETTER SEQUENCE: AVSEHQLLHDKGKSIQDLRRRFFLHHLIAEIHTAMOLECULAR FORMULA: C180H287N57O48MOLECULAR WEIGHT:4016.57STORAGE CONDITIONS: -20 5C, CAS REGISTRY NUMBER: [112955-31-4], RESEARCH AREA: OsteoporosisREFERENCES: L.J. Suva et al., Science, 237, 893 (1987)
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
TOKU-E Trimethoprim ReadyMade™ Solution | 25 mg/ML in DMSO | filter-sterile | 1 ML
Trimethoprim ReadyMade™ Solution | 25 mg/ML in DMSO | filter-sterile | 1 ML
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Sigma Aldrich Fine Chemicals Biosciences Cetylpyridinium chloride European Pharmacopoeia (EP) Reference Standard | 6004-24-6 | MFCD00149977 |
Cetylpyridinium chloride European Pharmacopoeia (EP) Reference Standard | Mol Wt: 358 | 6004-24-6 | MFCD00149977 |
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Biotium RUBP-4S 5MG
RUBP-4S 5MG
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
eMolecules 514-65-8 | Medchem Express | Biperiden | 5mg | 719835861 | HY-13204A | 311.469 | C21H29NO
Medchem Express | Biperiden | 5mg | 719835861 | HY-13204A | 514-65-8 | 311.469 | C21H29NO
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Biotium ACTINOMYCIN D 10MG
ACTINOMYCIN D 10MG
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
eMolecules 61698-07-5 | 3-(2-BROMOPHENYL)PROPANENITRILE | AstaTech | MFCD09836151 | 210.074 | C9H8BrN | 95.000 | Brc1ccccc1CCC#N | 0.1g | 721756650
3-(2-BROMOPHENYL)PROPANENITRILE | AstaTech | 61698-07-5 | MFCD09836151 | 210.074 | C9H8BrN | 95.000 | Brc1ccccc1CCC#N | 0.1g | 721756650
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Medchemexpress LLC HS-276 | 2767422-72-8 | 98.9% | 419.52 | 50 MG
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
HS-276 is an orally active, potent, and highly selective TAK1 inhibitor. It significantly inhibits multiple kinases including TAK1, CLK2, GCK, ULK2, MAP4K5, IRAK1, NUAK, CSNK1G2, CAMKKβ-1, and MLK1. This compound can be utilized for rheumatoid arthritis (RA) research, reducing the expression of TNF, IL-6, and IL-1β in a dose-dependent manner. In vivo studies have shown its effectiveness in reducing inflammation and related histological manifestations in a CIA mouse model of inflammatory arthritis.
- Potent and selective TAK1 inhibitor with a Ki of 2.5 nM
- Inhibits multiple kinases including CLK2, GCK, ULK2, MAP4K5, IRAK1, NUAK, CSNK1G2, CAMKKβ-1, and MLK1
- Reduces expression of TNF, IL-6, and IL-1β in vitro
- Effective in a CIA mouse model of inflammatory arthritis, reducing inflammation and bone damage
- Exhibits excellent bioavailability in CD-1 mice
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More