Antibiotics
- (3)
- (1)
- (1)
- (179)
- (26)
- (31)
- (6)
- (18)
- (1)
- (1)
- (41)
- (1)
- (8)
- (5)
- (31)
- (1)
- (2)
- (1)
- (1)
- (4)
- (1)
- (77)
- (10)
- (3)
- (48)
- (2)
- (1)
- (1)
- (1)
- (2)
- (3)
- (4)
- (5)
- (1)
- (2)
- (145)
- (7)
- (13)
- (4)
- (23)
- (4)
- (1)
- (28)
- (188)
- (6)
- (1)
- (23)
- (22)
- (1)
- (9)
- (1)
- (23)
- (1)
- (20)
- (1)
- (30)
- (1)
- (1)
- (24)
- (1)
- (2)
- (1)
- (11)
- (187)
- (10)
- (9)
- (4)
- (7)
- (111)
- (10)
- (1)
- (1)
- (561)
- (2)
- (16)
- (52)
- (3)
- (144)
- (1)
- (2)
- (1)
- (5)
- (1)
- (2)
- (2)
- (13)
- (3)
- (1)
- (4)
- (5)
- (1)
- (4)
- (2)
- (17)
- (1)
- (4)
- (7)
- (1)
- (3)
- (2)
- (4)
- (1)
- (2)
- (5)
- (1)
- (2)
- (5)
- (6)
- (2)
- (3)
- (1)
- (2)
- (1)
- (9)
- (3)
- (2)
- (2)
- (3)
- (3)
- (12)
- (2)
- (2)
- (2)
- (7)
- (3)
- (2)
- (2)
- (1)
- (2)
- (4)
- (6)
- (2)
- (2)
- (1)
- (1)
- (2)
- (1)
- (1)
- (1)
- (3)
- (5)
- (2)
- (1)
- (2)
- (2)
- (2)
- (1)
- (4)
- (2)
- (2)
- (5)
- (4)
- (2)
- (2)
- (1)
- (4)
- (7)
- (3)
- (2)
- (3)
- (1)
- (2)
- (2)
- (2)
- (3)
- (3)
- (2)
- (2)
- (3)
- (2)
- (1)
- (3)
- (2)
- (2)
- (3)
- (2)
- (1)
- (2)
- (4)
- (4)
- (2)
- (1)
- (3)
- (2)
- (1)
- (5)
- (9)
- (2)
- (1)
- (3)
- (4)
- (7)
- (1)
- (1)
- (2)
- (1)
- (1)
- (2)
- (3)
- (2)
- (1)
- (2)
- (7)
- (6)
- (3)
- (3)
- (2)
- (16)
- (1)
- (2)
- (2)
- (2)
- (2)
- (11)
- (1)
- (4)
- (3)
- (3)
- (2)
- (1)
- (4)
- (1)
- (11)
- (7)
- (2)
- (3)
- (1)
- (1)
- (2)
- (7)
- (2)
- (1)
- (1)
- (3)
- (2)
- (2)
- (4)
- (1)
- (1)
- (2)
- (3)
- (2)
- (2)
- (2)
- (3)
- (2)
- (1)
- (2)
- (2)
- (5)
- (1)
- (3)
- (4)
- (5)
- (6)
- (5)
- (4)
- (2)
- (1)
- (2)
- (5)
- (2)
- (4)
- (9)
- (9)
- (7)
- (4)
- (3)
- (1)
- (1)
- (2)
- (2)
- (1)
- (2)
- (2)
- (8)
- (1)
- (8)
- (2)
- (14)
- (3)
- (8)
- (1)
- (14)
- (2)
- (2)
- (3)
- (2)
- (4)
- (7)
- (3)
- (2)
- (3)
- (2)
- (3)
- (2)
- (17)
- (4)
- (1)
- (3)
- (2)
- (6)
- (2)
- (1)
- (1)
- (3)
- (6)
- (3)
- (2)
- (1)
- (1)
- (8)
- (4)
- (3)
- (6)
- (3)
- (5)
- (6)
- (1)
- (7)
- (9)
- (2)
- (1)
- (1)
- (1)
- (3)
- (3)
- (3)
- (1)
- (7)
- (1)
- (1)
- (9)
- (4)
- (1)
- (1)
- (3)
- (13)
- (5)
- (2)
- (1)
- (1)
- (1)
- (17)
- (8)
- (2)
- (4)
- (1)
- (1)
- (1)
- (4)
- (2)
- (1)
- (3)
- (2)
- (6)
- (5)
- (2)
- (8)
- (2)
- (2)
- (1)
- (1)
- (3)
- (2)
- (2)
- (2)
- (2)
- (1)
- (2)
- (2)
- (3)
- (1)
- (2)
- (2)
- (2)
- (1)
- (2)
- (7)
- (4)
- (2)
- (1)
- (3)
- (6)
- (4)
- (1)
- (2)
- (6)
- (2)
- (2)
- (3)
- (2)
- (3)
- (2)
- (1)
- (5)
- (5)
- (3)
- (8)
- (1)
- (2)
- (1)
- (5)
- (2)
- (3)
- (2)
- (2)
- (1)
- (1)
- (10)
- (2)
- (2)
- (7)
- (1)
- (2)
- (2)
- (2)
- (4)
- (1)
- (7)
- (1)
- (2)
- (2)
- (5)
- (5)
- (2)
- (2)
- (2)
- (1)
- (5)
- (3)
- (2)
- (1)
- (1)
- (3)
- (3)
- (1)
- (1)
- (5)
- (4)
- (4)
- (3)
- (1)
- (3)
- (2)
- (2)
- (4)
- (3)
- (2)
- (5)
- (1)
- (2)
- (3)
- (2)
- (4)
- (3)
- (2)
- (4)
- (2)
- (2)
- (13)
- (3)
- (2)
- (1)
- (2)
- (2)
- (5)
- (2)
- (3)
- (7)
- (6)
- (2)
- (4)
- (1)
- (2)
- (3)
- (9)
- (2)
- (7)
- (2)
- (2)
- (1)
- (5)
- (9)
- (1)
- (2)
- (4)
- (7)
- (4)
- (7)
- (5)
- (10)
- (2)
- (1)
- (2)
- (3)
- (10)
- (1)
- (2)
- (4)
- (1)
- (2)
- (3)
- (1)
- (1)
- (2)
- (5)
- (1)
- (1)
- (3)
- (11)
- (1)
- (3)
- (2)
- (10)
- (5)
- (1)
- (13)
- (1)
- (2)
- (2)
- (1)
- (1)
- (4)
- (1)
- (3)
- (1)
- (2)
- (3)
- (2)
- (8)
- (2)
- (1)
- (2)
- (1)
- (20)
- (1)
- (4)
- (2)
- (2)
- (1)
- (4)
- (1)
- (2)
- (2)
- (2)
- (3)
- (9)
- (2)
- (2)
- (5)
- (1)
- (3)
- (4)
- (1)
- (13)
- (11)
- (1)
- (3)
- (12)
- (7)
- (2)
- (2)
- (14)
- (3)
- (3)
- (3)
- (3)
- (4)
- (1)
- (5)
- (2)
- (1)
- (16)
- (1)
- (2)
- (2)
- (1)
- (1)
- (2)
- (7)
- (1)
- (2)
- (17)
- (7)
- (2)
- (8)
- (2)
- (3)
- (3)
- (2)
- (10)
- (5)
- (8)
- (5)
- (3)
- (1)
- (7)
- (2)
- (4)
- (2)
- (12)
- (2)
- (8)
- (5)
- (3)
- (9)
- (3)
- (6)
- (1)
- (4)
- (3)
- (398)
- (15)
- (2)
- (34)
- (19)
- (54)
- (28)
- (76)
Filtered Search Results
eMolecules 1430208-73-3 | Medchem Express | 1A-116 | 5mg | 446258536 | HY-104064 | 307.32 | C16H16F3N3
Medchem Express | GNE-371 | 5mg | 559839461 | HY-112803 | 1926986-36-8 | 431.496 | C24H25N5O3
If you are unable to find the chemical you are looking for, make sure you are logged into your fishersci.com account and click on the following link:
eMolecules Building Block Tool<|a>
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
![Medchemexpress LLC 2H-Furo[2,3-f]oxacyclotridecin-2-one, 4,6,8,10,12,14,16,18,20,22,23,24,25,26-tetradecahydro-3,13,15,17, | 579-13-5 | ≥99.9% | 791.06 | 50 MG](https://assets.fishersci.com/TFS-Assets/CCG/product-images/5000393824.png-250.jpg)
Medchemexpress LLC 2H-Furo[2,3-f]oxacyclotridecin-2-one, 4,6,8,10,12,14,16,18,20,22,23,24,25,26-tetradecahydro-3,13,15,17, | 579-13-5 | ≥99.9% | 791.06 | 50 MG
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Oligomycin A, produced by Streptomyces, functions as a mitochondrial F0F1-ATPase inhibitor with a Ki of 1 μM. It also exhibits anti-fungal properties and is intended for research use only.
- Targets mitochondrial F0F1-ATPase with a Ki of 1 μM.
- Shows anti-fungal activity.
- Exhibits cytotoxicity to NCI-60 cell lines with a GI50 of 10 nM.
- Inhibits Triton X-100-solubilized ATPase with a Ki of 0.1 μM.
- Inhibits spermatozoa's ability to achieve feasible in vitro capacitation (IVC) at 2.4 μM.
- Suppresses progesterone-induced in vitro acrosome exocytosis (IVAE) at 2.4 μM.
- Displays antiproliferative and antitumor effects against HCT-116 and K562 cells.
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Medchemexpress LLC HY-100775 5mg Medchemexpress, PBI-4050 (sodium salt) CAS:1254472-97-3 Purity:>98%
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Medchemexpress, HY-100775 5mg PBI-4050 (sodium salt) CAS:1254472-97-3 PBI-4050 sodium salt acts as an agonist for GPR40 and as an antagonist or inverse agonist for GPR84 . Purity:>98% Medchemexpress has over 10000 novel life-science reagents, reference compounds, APIs and natural compounds for laboratory and scientific use. Other quantity can also be offered.
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
![Medchemexpress LLC 4-benzhydryloxy-1-[3-(2H-tetrazol-5-yl)propyl]piperidine | 162641-16-9 | MFCD00936179 | 99.9% | 377.48 g·mol⁻¹ | C22H27N5O | 25 MG](https://assets.fishersci.com/TFS-Assets/CCG/product-images/5000242457.png-250.jpg)
Medchemexpress LLC 4-benzhydryloxy-1-[3-(2H-tetrazol-5-yl)propyl]piperidine | 162641-16-9 | MFCD00936179 | 99.9% | 377.48 g·mol⁻¹ | C22H27N5O | 25 MG
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
HQL-79 is a potent, selective, and orally active inhibitor of human hematopoietic prostaglandin D synthase (H-PGDS) used as a research tool to study prostaglandin D2 synthesis, allergic responses, and inflammatory signaling. The compound is supplied at high purity with documented solubility and storage parameters to support reproducible experimental work.
- Potent, selective inhibitor of hematopoietic prostaglandin D synthase (H-PGDS).
- Orally active profile supports in vivo pharmacology studies.
- High purity for reproducible biochemical and cellular assays.
- Documented solubility in DMSO simplifies assay preparation.
- Defined storage recommendations support long-term stability.
- Available in small research pack sizes for screening and dose-ranging.
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
eMolecules 22033-87-0 | Medchem Express | Olesoxime | 5mg | 446264570 | HY-14796 | 399.663 | C27H45NO
Ambeed | N-(1-((2R4S5R)-4-Hydroxy-5-(hydroxymethyl)tetrahydrofuran-2-yl)-2-oxo-12-dihydropyrimidin-4-yl)benzamide | 1g | 599357192 | A914066 | 4836-13-9 | MFCD00010115 | 331.328 | C16H17N3O5
If you are unable to find the chemical you are looking for, make sure you are logged into your fishersci.com account and click on the following link:
eMolecules Building Block Tool<|a>
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Apexbio Technology LLC Lomeguatrib 192441-08-0 10mg
Lomeguatrib (CAS 192441-08-0) is a potent inhibitor of O6-alkylguanine-DNA methyltransferase (MGMT) an enzyme involved in DNA repair that mitigates the cytotoxic effects of alkylating agents In MCF-7 cells Lomeguatrib inactivates MGMT with an approximate IC50 of 6 nM By suppressing MGMT activity Lomeguatrib sensitizes MGMT-expressing cell lines such as A375P and select mutBRAF and mutNRAS melanoma models to temozolomide but does not alter sensitivity to dacarbazine Clinical investigations have demonstrated dose-dependent inactivation of MGMT in patient-derived tumor tissues and peripheral blood mononuclear cells highlighting Lomeguatrib s value as a research tool for studying MGMT-mediated resistance mechanisms in cancer
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
eMolecules 325457-89-4 | Medchem Express | ICA-27243 | 5mg | 515744011 | HY-122114 | MFCD17166959 | 268.65 | C12H7ClF2N2O
Ambeed | 2-((2-(Cyclohexyl(methyl)amino)-2-oxoethyl)thio)acetic acid | 1g | 572847607 | A1010575 | 790232-10-9 | MFCD06356453 | 245.340 | C11H19NO3S
If you are unable to find the chemical you are looking for, make sure you are logged into your fishersci.com account and click on the following link:
eMolecules Building Block Tool<|a>
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Medchemexpress LLC HY-15532B 5mg Medchemexpress, SCH900776 (S-isomer) CAS:891494-64-7 Purity:>98%
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Medchemexpress, HY-15532B 5mg SCH900776 (S-isomer) CAS:891494-64-7 SCH900776 S-isomer is the S-isomer of SCH900776. SCH900776 is a potent, selective and orally bioavailable inhibitor of checkpoint kinase1 (Chk1) with IC50 of 3 nM. Purity:>98% Medchemexpress has over 10000 novel life-science reagents, reference compounds, APIs and natural compounds for laboratory and scientific use. Other quantity can also be offered.
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Apexbio Technology LLC Rifaximin (Xifaxan), 500mg. Cas: 80621-81-4 MFCD: MFCD00864973. RNA synthesis inhibitor, PXR activator
Rifaximin, a rifamycin derivative, is a nonabsorbable antibiotic. Rifaximin inhibits RNA synthesis by binding the subunit of the bacterial DNA-dependent RNA polymerase. Other sizes are available. Please inqury us for quote.
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Medchemexpress LLC Cdk5 inhibitor 20-223 | 865317-30-2 | MFCD32857141 | 99.6% | 305.37 | C19H19N3O | 25MG
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
CDK5 inhibitor 20-223 is a small-molecule kinase inhibitor active against CDK2 and CDK5, with low-nanomolar enzymatic potency and demonstrated cellular activity in colorectal cancer models. It is supplied as a light yellow to yellow solid for laboratory research, provided with high purity and recommended cold storage for long-term stability.
- Potent CDK2 and CDK5 inhibition with IC50s of ~6.0 nM and ~8.8 nM.
- Demonstrated cellular activity in colorectal cancer cell lines.
- High purity suitable for research applications.
- Light yellow to yellow solid for ease of handling.
- Molecular formula C19H19N3O and molecular weight 305.37.
- Recommended cold storage for long-term stability.
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
CPC Scientific H-Ala-Val-Ser-Glu-His-Gln-Leu-Leu-His-Asp-Lys-Gly-Lys-Ser-Ile-Gln-Asp-Leu-Arg-Arg-Arg-Phe-Phe-Leu-His-His-Leu-Ile-Ala-Glu-Ile-His-Thr-Ala-Glu-Ile-Arg-Ala-Thr-Ser-OH (trifluoroacetate salt) 1MG
A parathyroid hormone (PTH)-related peptide (1-40), human.ONE-LETTER SEQUENCE: AVSEHQLLHDKGKSIQDLRRRFFLHHLIAEIHTAEIRATSMOLECULAR FORMULA: C207H334N66O58MOLECULAR WEIGHT:4675.34STORAGE CONDITIONS: -20 5C, CAS REGISTRY NUMBER: [120298-73-9], SYNONYMS: pTH-Related Protein (1-40) (human, mouse, rat)RESEARCH AREA: Osteoporosis
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Teknova 30mg/mL Gentamicin Solution. 100mL, Sterile.
Premade antibiotic solutions are ready-to-use as a supplement for your tissue culture, bacteria media or other specific needs. Antibiotics are often used in cell culture to prevent contamination, maintain aseptic conditions, or select for cells containing genetic modifications.
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Medchemexpress LLC HY-17596 200mg Medchemexpress, Closantel CAS:57808-65-8 Purity:>98%
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Medchemexpress, HY-17596 200mg Closantel CAS:57808-65-8 Closantel is a halogenated salicylanilide with a potent anti-parasitic activity. Closantel is a potent and highly specific Onchocerca volvulus chitinase (OvCHT1) inhibitor with an IC50 of 1.6 μM and a Ki of 468 nM. Closantel inhibits the O. volvulus L3 to L4 molt of developing. Purity:>98% Medchemexpress has over 10000 novel life-science reagents, reference compounds, APIs and natural compounds for laboratory and scientific use. Other quantity can also be offered.
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Phenomenex Inc joins four 360um OD tubing w/Fittings (MAX 5,000 psi / 345 bar)
Cross Assembly, PEEK, 0.006" thruhole AN0-1041
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Medchemexpress LLC Lumefantrine-d9 (Benflumetol-d9) | 2477594-24-2 | 97.0% | 5 MG
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Lumefantrine-d9 is a deuterium-labeled version of Lumefantrine, an antimalarial drug. It is commonly used in combination with Artemether, forming a combination therapy (AL) that serves as a first- and second-line antimalarial treatment.
- Can be utilized as a tracer in research applications.
- Serves as an internal standard for quantitative analysis using techniques such as NMR, GC-MS, or LC-MS.
- Stable isotope used for quantitation during drug development processes, with potential to influence pharmacokinetic and metabolic profiles of drugs.
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More