Antibiotics
- (3)
- (1)
- (1)
- (165)
- (26)
- (31)
- (6)
- (18)
- (1)
- (1)
- (36)
- (1)
- (8)
- (5)
- (28)
- (1)
- (2)
- (1)
- (1)
- (4)
- (1)
- (72)
- (10)
- (3)
- (44)
- (2)
- (1)
- (1)
- (2)
- (3)
- (4)
- (5)
- (1)
- (2)
- (138)
- (7)
- (13)
- (4)
- (23)
- (5)
- (1)
- (27)
- (174)
- (6)
- (1)
- (23)
- (22)
- (1)
- (9)
- (1)
- (23)
- (1)
- (19)
- (1)
- (29)
- (1)
- (1)
- (24)
- (1)
- (2)
- (1)
- (144)
- (1)
- (2)
- (1)
- (5)
- (1)
- (2)
- (2)
- (13)
- (3)
- (1)
- (4)
- (5)
- (1)
- (4)
- (2)
- (17)
- (1)
- (4)
- (7)
- (1)
- (3)
- (2)
- (4)
- (1)
- (2)
- (5)
- (1)
- (2)
- (5)
- (6)
- (2)
- (3)
- (1)
- (2)
- (1)
- (9)
- (3)
- (2)
- (2)
- (3)
- (3)
- (12)
- (2)
- (2)
- (2)
- (7)
- (3)
- (2)
- (2)
- (1)
- (2)
- (4)
- (6)
- (2)
- (2)
- (1)
- (1)
- (2)
- (1)
- (1)
- (1)
- (3)
- (5)
- (2)
- (1)
- (2)
- (2)
- (2)
- (1)
- (4)
- (2)
- (2)
- (5)
- (4)
- (2)
- (2)
- (1)
- (5)
- (7)
- (3)
- (2)
- (3)
- (1)
- (2)
- (2)
- (2)
- (3)
- (3)
- (2)
- (2)
- (3)
- (2)
- (1)
- (3)
- (2)
- (2)
- (3)
- (2)
- (1)
- (2)
- (4)
- (4)
- (2)
- (1)
- (3)
- (2)
- (1)
- (5)
- (9)
- (2)
- (1)
- (3)
- (4)
- (7)
- (1)
- (1)
- (2)
- (1)
- (1)
- (2)
- (3)
- (2)
- (1)
- (2)
- (7)
- (6)
- (3)
- (3)
- (2)
- (16)
- (1)
- (2)
- (2)
- (2)
- (2)
- (11)
- (1)
- (4)
- (3)
- (3)
- (2)
- (1)
- (4)
- (1)
- (11)
- (7)
- (2)
- (3)
- (1)
- (1)
- (2)
- (7)
- (2)
- (1)
- (1)
- (3)
- (2)
- (2)
- (4)
- (1)
- (1)
- (2)
- (3)
- (2)
- (2)
- (2)
- (3)
- (2)
- (1)
- (2)
- (2)
- (5)
- (1)
- (3)
- (4)
- (5)
- (6)
- (5)
- (4)
- (2)
- (1)
- (2)
- (5)
- (2)
- (4)
- (9)
- (9)
- (7)
- (4)
- (3)
- (1)
- (1)
- (2)
- (2)
- (1)
- (2)
- (2)
- (8)
- (1)
- (8)
- (2)
- (14)
- (3)
- (8)
- (1)
- (14)
- (2)
- (2)
- (3)
- (2)
- (4)
- (7)
- (3)
- (2)
- (3)
- (2)
- (3)
- (2)
- (17)
- (4)
- (1)
- (3)
- (2)
- (6)
- (2)
- (1)
- (1)
- (3)
- (6)
- (3)
- (2)
- (1)
- (1)
- (8)
- (4)
- (3)
- (6)
- (3)
- (5)
- (6)
- (1)
- (7)
- (9)
- (2)
- (1)
- (1)
- (11)
- (186)
- (10)
- (9)
- (4)
- (7)
- (111)
- (10)
- (1)
- (1)
- (507)
- (2)
- (17)
- (52)
- (3)
- (1)
- (3)
- (3)
- (3)
- (7)
- (1)
- (1)
- (9)
- (4)
- (3)
- (13)
- (5)
- (2)
- (17)
- (8)
- (2)
- (4)
- (1)
- (1)
- (1)
- (4)
- (1)
- (1)
- (2)
- (6)
- (5)
- (2)
- (8)
- (2)
- (1)
- (1)
- (3)
- (2)
- (2)
- (2)
- (1)
- (2)
- (2)
- (3)
- (2)
- (2)
- (2)
- (2)
- (7)
- (4)
- (1)
- (3)
- (6)
- (5)
- (1)
- (6)
- (2)
- (2)
- (3)
- (2)
- (3)
- (1)
- (1)
- (4)
- (5)
- (3)
- (8)
- (1)
- (2)
- (1)
- (5)
- (3)
- (2)
- (2)
- (1)
- (10)
- (2)
- (2)
- (7)
- (1)
- (2)
- (4)
- (7)
- (2)
- (5)
- (5)
- (2)
- (2)
- (2)
- (1)
- (5)
- (3)
- (2)
- (3)
- (3)
- (1)
- (1)
- (5)
- (4)
- (4)
- (1)
- (3)
- (4)
- (3)
- (2)
- (5)
- (1)
- (3)
- (2)
- (4)
- (3)
- (2)
- (4)
- (2)
- (2)
- (13)
- (3)
- (2)
- (1)
- (1)
- (2)
- (5)
- (3)
- (7)
- (6)
- (2)
- (4)
- (1)
- (2)
- (3)
- (9)
- (2)
- (7)
- (2)
- (2)
- (1)
- (5)
- (9)
- (1)
- (2)
- (4)
- (7)
- (4)
- (7)
- (5)
- (10)
- (2)
- (2)
- (3)
- (10)
- (1)
- (2)
- (4)
- (1)
- (2)
- (3)
- (1)
- (2)
- (5)
- (1)
- (3)
- (11)
- (1)
- (3)
- (2)
- (10)
- (5)
- (1)
- (13)
- (1)
- (2)
- (2)
- (1)
- (1)
- (4)
- (1)
- (3)
- (1)
- (2)
- (3)
- (2)
- (8)
- (2)
- (1)
- (2)
- (1)
- (20)
- (1)
- (4)
- (2)
- (1)
- (4)
- (1)
- (2)
- (2)
- (2)
- (3)
- (9)
- (2)
- (5)
- (3)
- (4)
- (1)
- (13)
- (11)
- (1)
- (3)
- (12)
- (7)
- (2)
- (2)
- (14)
- (3)
- (3)
- (3)
- (3)
- (4)
- (1)
- (5)
- (2)
- (1)
- (16)
- (1)
- (2)
- (2)
- (1)
- (2)
- (7)
- (1)
- (2)
- (17)
- (7)
- (2)
- (8)
- (2)
- (3)
- (3)
- (2)
- (10)
- (5)
- (8)
- (5)
- (3)
- (1)
- (7)
- (2)
- (4)
- (2)
- (12)
- (2)
- (8)
- (5)
- (3)
- (9)
- (3)
- (6)
- (1)
- (4)
- (3)
- (399)
- (15)
- (2)
- (34)
- (19)
- (54)
- (28)
- (76)
Filtered Search Results
Cayman Chemical ANTIBODY RIfampIcIn 5g
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
A rifamycin antibiotic; inhibits bacterial RNA polymerase (IC50 = 0.01 μg/ml for the E. coli enzyme); inhibits the growth of M. tuberculosis H37Rv in mouse peritoneal macrophages (MIC = 0.8 μg/ml) as well as clinical isolates of various species of Staphylococcus, Streptococcus, Haemophilus, and Neisseria (MICs = 0.009-1.4 μg/ml); increases survival in a mouse model of tuberculosis infection; an agonist of the human PXR (EC50 = ~2 μM)
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Apexbio Technology LLC Salinomycin, 5mg. Cas: 53003-10-4 MFCD: MFCD00865281. Polyether ionophore antibiotic;anti-cancer
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
IC50: 7.7, 13.7 and 10.4 M for HepG2, SMMC-7721 and BEL-7402 cell line, respectively (after 24h treatment)Salinomycin (Sal), which is a polyether ionophore antibiotic from Streptomyces albus, has been proven to be able to kill different types of human cancer cells. Other sizes are available. Please inqury us for quote.
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Medchemexpress LLC HY-15222 5mg Medchemexpress, Menin-MLL inhibitor MI-2 CAS:1271738-62-5 Purity:>98%
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Medchemexpress, HY-15222 5mg Menin-MLL inhibitor MI-2 CAS:1271738-62-5 Menin-MLL inhibitor MI-2 is a Menin-MLL interaction inhibitor with IC50 of 446±28 nM. Purity:>98% Medchemexpress has over 10000 novel life-science reagents, reference compounds, APIs and natural compounds for laboratory and scientific use. Other quantity can also be offered.
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Apexbio Technology LLC Cetylpyridinium Chloride 123-03-5 50mg
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Cetylpyridinium chloride (CAS 123-03-5) is a small-molecule inhibitor targeting microbial cell membranes It is designed to disrupt bacterial lipid bilayers thereby altering membrane permeability and inhibiting microbial viability Cetylpyridinium chloride exerts its biological activity primarily through membrane destabilization via positively charged cetylpyridinium ions interacting with negatively charged microbial surfaces In in vitro studies cetylpyridinium chloride demonstrates inhibitory activity with IC50 values ranging approximately between 0 5 to 10 M depending on microbial strain type and experimental conditions Based on these pharmacological properties cetylpyridinium chloride holds research potential in evaluating oral microbial inhibition biofilm formation interference and cell membrane-targeted antibacterial strategies
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Sigma Aldrich Fine Chemicals Biosciences Cetylpyridinium chloride United States Pharmacopeia (USP) Reference Standard | 6004-24-6 | MFCD00149977 | 500MG
Cetylpyridinium chloride United States Pharmacopeia (USP) Reference Standard | Mol Wt: 358 | 6004-24-6 | MFCD00149977 | 500MG
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Carbosynth LLC. Letrozole (USP grade powder), 200 mg
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Letrozole (USP grade powder) chemical reference substance
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Medchemexpress LLC HY-100888 50mg Medchemexpress, Simurosertib CAS:1330782-76-7 Purity:>98%
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Medchemexpress, HY-100888 50mg Simurosertib CAS:1330782-76-7 Simurosertib (TAK-931) is a selective cycle 7 (CDC7) kinase inhibitor, with an IC 50 <0.3 nM. Purity:>98% Medchemexpress has over 10000 novel life-science reagents, reference compounds, APIs and natural compounds for laboratory and scientific use. Other quantity can also be offered.
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Apexbio Technology LLC Etifoxine hydrochloride 56776-32-0 10mg
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Etifoxine hydrochloride (CAS 56776-32-0) is a small molecule that modulates GABAA receptor activity with selectivity towards receptors containing 2 or 3 subunits In neuronal cell culture models it enhances GABAA receptor-mediated responses Etifoxine also binds to the translocator protein (TSPO) a mitochondrial protein involved in neurosteroidogenesis In preclinical and clinical studies etifoxine demonstrates anxiolytic effects without producing sedative muscle relaxant or cognitive impairment typically associated with benzodiazepines Additionally it has been reported to promote axonal regeneration supporting its utility in neuropharmacological and neuroregeneration research
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Cayman Chemical RoxIthromycIn 10g
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
A macrolide antibiotic; active against five strains EAch of Staphylococcus and Streptococcus (geometric mean MICs = 0.08 and 0.79 UG/ml, respectively), as well as several strains EAch of Corynebacterium, Haemophilus, and S. pneumoniae (MIC50s = 0.02, 0.01, and 2.5 UG/ml, respectively); protective against infection by strains of S. aureus, S. pyogenes, S. pneumoniae, or L. monocytogenes in mice (PD50s = 23-98 mg/kg)
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
CPC Scientific H-Ala-Val-Ser-Glu-His-Gln-Leu-Leu-His-Asp-Lys-Gly-Lys-Ser-Ile-Gln-Asp-Leu-Arg-Arg-Arg-Phe-Phe-Leu-His-His-Leu-Ile-Ala-Glu-Ile-His-Thr-Ala-OH (trifluoroacetate salt) 0.5MG
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Peptide found to have anabolic effect on bone formation in rats that can inhibit the rapid decline in bone formation due to denervation.ONE-LETTER SEQUENCE: AVSEHQLLHDKGKSIQDLRRRFFLHHLIAEIHTAMOLECULAR FORMULA: C180H287N57O48MOLECULAR WEIGHT:4016.57STORAGE CONDITIONS: -20 5C, CAS REGISTRY NUMBER: [112955-31-4], RESEARCH AREA: OsteoporosisREFERENCES: L.J. Suva et al., Science, 237, 893 (1987)
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
TOKU-E Trimethoprim ReadyMade™ Solution | 25 mg/ML in DMSO | filter-sterile | 1 ML
Trimethoprim ReadyMade™ Solution | 25 mg/ML in DMSO | filter-sterile | 1 ML
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Medchemexpress LLC HY-19364 5mg Medchemexpress, Ferroquine CAS:185055-67-8 Purity:>98%
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Medchemexpress, HY-19364 5mg Ferroquine CAS:185055-67-8 Ferroquine (Ferrochloroquine), a ferrocenyl analogue of Chloroquine, is an antimalarial agent. Ferroquine shows parasiticidal effect on Plasmodium by inducing oxidative stress and the subsequent destruction of the membrane. Purity:>98% Medchemexpress has over 10000 novel life-science reagents, reference compounds, APIs and natural compounds for laboratory and scientific use. Other quantity can also be offered.
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Alkali Scientific Clindamycin HCl, 5 G
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Clindamycin HCl is a lincosamide antibiotic widely used in microbiology and biochemical research to inhibit bacterial protein synthesis. It acts by binding to the 50S ribosomal subunit, blocking peptide bond formation and preventing bacterial growth. This antibiotic is effective against a range of Gram-positive organisms and anaerobic bacteria, making it useful in selective culture conditions and antimicrobial assays. It is commonly utilized in laboratory studies investigating bacterial susceptibility, resistance patterns, and protein translation mechanisms. Clindamycin is suitable for in vitro applications, including cell culture systems and biochemical experiments focused on antibiotic activity and microbial physiology.
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Biotium MTS-ATFB 10MG
MTS-ATFB 10MG
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Biotium RUBP-4S 5MG
RUBP-4S 5MG
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More