Sera
Electron Microscopy Sciences Aurion Normal Goat Serum 5 ML
Normal sera are used to counteract the non-specific interaction between the sample and immunoglobulins. They can be added to the blocking solution and the incubation media. As a rule the normal serum species should be the same as the secondary antibody species (use normal goat serum with goat-anti-rabbit conjugates). Note: normal sera should not be used in combination with Protein A and Protein G gold reagents.
Cayman Chemical EP4 ReceptrC-Term BlockIn 1ea
Peptide Sequence: human EP4 receptor sequence amino acids 459-488 (GSGRAGPAPKGSSLQVTFPSETLNLSEKCI) · To be used in conjunction with Cayman’s EP4 Receptor Polyclonal Antibody (Item No. 101775) to block protein-antibody complex formation during immunochemical analysis for the EP4 receptor.
MARIAN MEDICAL INC Disposable ENFit Syringe, 100 ml, 30 Per Box
Syringe. Disposable Syringe. Marian Medical Inc. ME100. Disposable syringe for single patient use. Manufactured to ISO 80369 3 connection standards. Sterile individually packaged syringe. Clear barrel with easy to read graduations. For medication administration in clinical and home care settings. 30 per box.
Sigma Aldrich Fine Chemicals Biosciences NORMAL HUMAN INTRAHEPATIC BILI
NC3365961 NORMAL HUMAN INTRAHEPATIC BILI
Cayman Chemical DL-CarnItIn-d9chlorIde 50mg
An internal standard for the quantification of carnitine by GC- or LC-MS