accessibility menu, dialog, popup

UserName
Viewing profile as user:

Primary Antibodies

Primary antibodies are immunoglobulins that recognize and bind to a specific antigen of interest with high affinity and specificity to purify, detect, and measure that antigen. Includes antibody pairs for specific biochemical applications.
All Primary Antibodies (1,218,593)
Primary Antibody Matched Pairs (4,058)
Protein Interaction Antibody Pairs (625)
Protein Phosphorylation Antibody Pairs (53)

Filtered Search Results

Products from some of our suppliers do not display in filtered search results. Please clear all filters to see these products.

Narrow Results

Narrow Results

No results found within this category. Try removing some selected filters and try again.

category

special offers

  • (896)
  • (1)
  • (895)
  • (608)
  • (608)

brands

  • (1)
  • (1)
  • (1)
  • (2,337)
  • (218)
  • (11)
  • (1)
  • (16)
  • (43)
  • (50)
  • (1)
  • (1,018)
  • (74,148)
  • (4)
  • (61,291)
  • (2)
  • (1)
  • (111)
  • (1,327)
  • (589)
  • (10)
  • (1)
  • (33)
  • (1)
  • (3)
  • (2)
  • (4)
  • (1)
  • (30)
  • (1)
  • (2)
  • (11)
  • (5)
  • (1)
  • (810)
  • (8)
  • (6)
  • (2)
  • (1)
  • (6)
  • (2)
  • (2)
  • (1)
  • (4)
  • (8)
  • (1)
  • (5)
  • (10)
  • (1)
  • (4)
  • (17)
  • (1)
  • (11)
  • (2)
  • (1)
  • (1)
  • (9)
  • (18)
  • (14,218)
  • (31)
  • (3)
  • (27,244)
  • (48)
  • (5)
  • (4)
  • (460)
  • (2)
  • (1)
  • (12,496)
  • (1)
  • (1)
  • (10)
  • (593)
  • (2)
  • (143)
  • (1)
  • (440)
  • (107)
  • (23,254)
  • (3,593)
  • (1)
  • (1)
  • (1)
  • (11,135)
  • (78)
  • (1,122)
  • (230)
  • (2)
  • (2)
  • (62)
  • (1)
  • (2)
  • (2)
  • (2)
  • (1)
  • (3)
  • (24)
  • (12)
  • (440)
  • (8,727)
  • (19)
  • (3)
  • (2)
  • (3)
  • (4)
  • (6,220)
  • (1)
  • (1)
  • (1)
  • (9)
  • (6)
  • (2)
  • (21)
  • (2)
  • (3)
  • (12)
  • (2)
  • (15)
  • (1)
  • (21)
  • (35)
  • (13)
  • (2)
  • (1)
  • (26)
  • (497)
  • (24)
  • (11)
  • (11)
  • (9)
  • (4)
  • (6)
  • (2)
  • (65)
  • (1)
  • (20)
  • (10)
  • (1)
  • (380)
  • (1)
  • (1)
  • (1)
  • (5)
  • (2)
  • (220)
  • (2)
  • (96)
  • (168)
  • (2)
  • (152)
  • (1)
  • (10)
  • (1)
  • (204)
  • (2,059)
  • (1)
  • (114)
  • (2,519)
  • (181)
  • (9)
  • (1)
  • (1)
  • (1)
  • (1,052)
  • (1)
  • (2)
  • (8)
  • (133)
  • (1)
  • (1)
  • (1)
  • (1)
  • (1)
  • (1)
  • (75)
  • (708)
  • (1)
  • (1)
  • (1)
  • (1)
  • (1)
  • (1)
  • (1)
  • (19)
  • (5)
  • (18)
  • (1)
  • (12)
  • (9)
  • (2)
  • (1)
  • (1)
  • (2)
  • (46)
  • (35)
  • (1)
  • (1)
  • (14)
  • (1)
  • (3)
  • (1)
  • (1)
  • (18,232)
  • (18,093)
  • (33)
  • (263)
  • (1)
  • (1)
  • (1)
  • (185)
  • (2)
  • (1)
  • (2)
  • (517)
  • (1,693)
  • (2)
  • (7)
  • (1)
  • (1)
  • (465)
  • (145)
  • (13)
  • (23)
  • (1)
  • (1)
  • (2)
  • (3)
  • (186)
  • (90)
  • (4)
  • (1)
  • (9)
  • (1)
  • (9,588)
  • (1)
  • (14)
  • (2)
  • (52)
  • (1)
  • (2)
  • (1)
  • (8)
  • (7)
  • (3)
  • (3)
  • (1)
  • (1)
  • (1)
  • (1)
  • (1)
  • (1)
  • (680,008)
  • (13)
  • (1)
  • (2)
  • (30,422)
  • (29)
  • (1)
  • (1)
  • (635)
  • (71)
  • (1)
  • (1)
  • (2)
  • (6)
  • (1)
  • (1)
  • (1)
  • (1)
  • (1)
  • (122)
  • (1)
  • (6)
  • (2)
  • (11)
  • (11,508)
  • (1)
  • (4)
  • (1)
  • (1)
  • (1)
  • (7)
  • (59)
  • (37,709)
  • (2)
  • (15)
  • (5)
  • (39)
  • (517)
  • (1)
  • (1)
  • (5)
  • (2,465)
  • (2)
  • (3)
  • (838)
  • (185)
  • (1)
  • (5)
  • (4)
  • (1)
  • (3)
  • (90)
  • (120)
  • (1)
  • (1)
  • (704)
  • (182)
  • (11,167)
  • (1,799)
  • (4)
  • (1)
  • (1)
  • (3)
  • (1)
  • (1)
  • (9)
  • (10)
  • (1)
  • (4)
  • (4)
  • (1)
  • (1)
  • (1)
  • (1)
  • (1)
  • (8)
  • (1)
  • (2)
  • (124,068)
  • (8)
  • (74)
  • (1)
  • (11)
  • (913)
  • (1)
  • (2)
  • (1)
  • (1)
  • (2)
  • (2)
  • (7)
  • (1)
  • (1)
  • (11)
  • (274)
  • (4)
  • (2)
  • (1)
  • (1)
  • (8)
  • (9)
  • (3)
  • (1)
  • (1)
  • (1)
  • (2)
  • (40)
  • (7)
  • (1)
  • (3)
  • (915)
  • (2)
  • (3)

special interests

  • (154)
  • (6,726)
  • (36,369)
  • (789,558)

Quantity

  • (1)
  • (2)
  • (1)
  • (3,051)
  • (867)
  • (1,742)
  • (4,057)
Show all

Classification

  • (103)
  • (105)
  • (538,678)
  • (3,642)
  • (11)
  • (483,217)
  • (20,559)
Show all

Conjugate

  • (16,086)
  • (9)
  • (1)
  • (20)
  • (2,768)
  • (74)
  • (89)
Show all

Host Species

  • (508)
  • (2,392)
  • (38)
  • (1)
  • (14)
  • (1,429)
  • (2)
Show all

Applications

  • (36)
  • (147)
  • (240)
  • (90)
  • (5)
  • (340)
  • (89)
Show all

Target Species

  • (1)
  • (18)
  • (15)
  • (127)
  • (2)
  • (5)
  • (1,409)
Show all

Isotype

  • (2)
  • (1)
  • (2)
  • (21)
  • (4)
  • (1)
  • (46)
Show all

Regulatory Status

  • (333)
  • (962)
  • (959,063)

Form

  • (2,819)
  • (2,209)
  • (1,635)
  • (14)
  • (11)
  • (21)
  • (260,274)
Show all

Research Discipline

  • (1)
  • (1)
  • (1)
  • (2)
  • (1)
  • (2)
  • (2)
Show all
1 – 15 of 1,150,345 results
1

Invitrogen™ Calreticulin Polyclonal Antibody

Rabbit Polyclonal Antibody

EDGE
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Target Species Human,Mouse,Rat,Canine,Rabbit,Monkey
Host Species Rabbit
Conjugate Unconjugated
Applications Flow Cytometry,Immunohistochemistry,Immunoprecipitation,Western Blot,Immunocytochemistry
Form Liquid
Gene Accession No. P14211, P15253, P18418, P27797, P28490
Isotype IgG
Concentration Conc. Not Determined
Antigen Calreticulin
Gene Symbols CALR
Regulatory Status RUO
Gene Alias Autoantigen RO; CABP3; CALBP; calcium-binding protein 3; CALR; calrectulin; calregulin; Calreticulin; calreticulin precursor; cC1qR; CRP55; CRT; CRTC; Endoplasmic reticulum resident protein 60; epididymis secretory sperm binding protein Li 99n; ERp60; FLJ26680; grp60; HACBP; HEL-S-99n; I79_008346; RO; Ro/SS-A Antigen; Sicca syndrome antigen A (autoantigen Ro; calreticulin); SSA
Gene CALR
Product Type Antibody
Gene ID (Entrez) 100009050, 100350417, 12317, 476694, 64202, 811
Formulation Whole serum with 0.05% sodium azide
Immunogen Recombinant, human calreticulin protein.
Classification Polyclonal
Primary or Secondary Primary
2

Human/Mouse Syntaxin 12 Antibody, R&D Systems™
GREENER_CHOICE

Goat Antibody

Content And Storage Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 °C as supplied. 1 month, 2 to 8 °C under sterile conditions after reconstitution. 6 months, -20 to -70 °C under sterile conditions after reconstitution.
Target Species Human,Mouse
Host Species Goat
Conjugate Unconjugated
Applications Immunohistochemistry
Form Lyophilized
Isotype IgG
Gene Accession No. Q86Y82
Antigen Syntaxin 12
Purification Method Antigen Affinity-purified
Dilution Immunohistochemistry 1-15 μg/mL
Gene Alias MGC51957, STX12, STX13, STX14, syntaxin 12, syntaxin-12
Gene ID (Entrez) 23673.0
Formulation Lyophilized from a 0.2 μm filtered solution in PBS with Trehalose. *Small pack size (SP) is supplied as a 0.2 μm filtered solution in PBS.
Immunogen E.coli-derived recombinant human Syntaxin 12, Met1-Gln200, Accession No. Q86Y82
Classification Polyclonal
Reconstitution Reconstitute at 0.5 mg/mL in sterile PBS.
Primary or Secondary Primary
Test Specificity Detects human Syntaxin 12 in direct ELISAs. Detects human and mouse Syntaxin 12 in immunohistochemistry.
4

Invitrogen™ GFP Polyclonal Antibody

Rabbit Polyclonal Antibody

EDGE ENCOMPASS_PREFERRED
Content And Storage 4°C
Target Species Tag
Host Species Rabbit
Conjugate Unconjugated
Applications Immunohistochemistry,Western Blot,Immunocytochemistry
Form Liquid
Isotype IgG
Concentration 2 mg/mL
Antigen GFP
Regulatory Status RUO
Purification Method IgG fraction
Gene Alias GFP; GFP tag; GFP2; green fluorescence; green fluorescent; Turbo eGFP
Product Type Antibody
Formulation PBS with 5mM sodium azide; pH 7.2
Immunogen The GFP was isolated directly from the jellyfish Aequorea victoria.
Classification Polyclonal
Primary or Secondary Primary
5

Alpha-Smooth Muscle Actin Monoclonal Antibody (1A4), eFluor™ 660, eBioscience™, Invitrogen™

Mouse Monoclonal Antibody

EDGE ENCOMPASS_PREFERRED
Content And Storage 4°C, store in dark, DO NOT FREEZE!
Target Species Human,Mouse,Rat
Host Species Mouse
Conjugate eFluor 660
Applications Immunohistochemistry,Immunohistochemistry (Frozen),Immunohistochemistry (Paraffin),Western Blot,Immunocytochemistry
Form Liquid
Isotype IgG2a κ
Gene Accession No. P62736, P62737, P62738
Concentration 0.2 mg/mL
Antigen Alpha-Smooth Muscle Actin
Gene Symbols ACTA2
Regulatory Status RUO
Purification Method Affinity chromatography
Gene Alias 0610041G09Rik; AAT6; ACT-4; acta2; acta2.L; acta2.S; actin; Actin Alpha 2 Smooth Muscle Aorta; actin alpha 2, smooth muscle; Actin Vascular Smooth Muscle; actin, alpha 2, smooth muscle, aorta; actin, alpha 2, smooth muscle, aorta L homeolog; actin, alpha 2, smooth muscle, aorta S homeolog; actin, alpha, vascular smooth muscle; actin, aortic smooth muscle; Actin, aortic smooth muscle, intermediate form; ACTSA; ACTVS; alpha actin 2; Alpha Cardiac Actin; alpha smooth muscle actin; alpha-actin; Alpha-actin-2; alpha-cardiac actin; alphaSMA; alpha-SM-actin; alpha-smooth muscle actin; Aortic Smooth Muscle; asma; a-sma; cell growth-inhibiting gene 46 protein; GIG46; Growth Inhibiting Gene 46; hypothetical protein LOC515610; LOW QUALITY PROTEIN: actin, aortic smooth muscle; mymy5; SM actin; sma; SMactin; sm-actin; SMalphaA; smooth muscle; smooth muscle alpha-actin; vascular smooth muscle alpha-actin; wu:fb63d03; XELAEV_18034370mg
Gene ACTA2
Product Type Antibody
Gene ID (Entrez) 11475, 59, 81633
Formulation PBS with 0.09% sodium azide; pH 7.2
Classification Monoclonal
Primary or Secondary Primary
Clone 1A4
6

Human GLP-1 Antibody, R&D Systems™
GREENER_CHOICE

Rabbit Monoclonal Antibody

Content And Storage Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70°C as supplied. 1 month, 2 to 8°C under sterile conditions after reconstitution. 6 months, -20 to -70°C under sterile conditions after reconstitution.
Target Species Human
Host Species Rabbit
Conjugate Unconjugated
Applications ELISA
Form Purified
Isotype IgG
Gene Accession No. P01275
Antigen GLP1
Regulatory Status RUO
Purification Method Protein A or G purified from cell culture supernatant
Gene Alias glicentin-related polypeptide, GLP1, glucagon-like peptide 1, GRPP
Gene ID (Entrez) 2641
Formulation Lyophilized from a 0.2 μm filtered solution in PBS with Trehalose. *Small pack size (SP) is supplied as a 0.2 μm filtered solution in PBS.
Immunogen Human GLP-1 synthetic peptide, Accession # P01275
Classification Monoclonal
Reconstitution Reconstitute at 0.5 mg/mL in sterile PBS.
Primary or Secondary Primary
Clone 2622G
10

Invitrogen™ MAP2 Monoclonal Antibody (M13)

Mouse Monoclonal Antibody

EDGE ENCOMPASS_PREFERRED
Content And Storage -20°C
Target Species Human,Mouse,Rat
Host Species Mouse
Conjugate Unconjugated
Applications ELISA,Immunohistochemistry,Immunoprecipitation,Western Blot,Immunocytochemistry
Form Liquid
Gene Accession No. P11137, P15146, P20357
Isotype IgG1 κ
Concentration 0.5 mg/mL
Antigen MAP2
Gene Symbols Map2
Regulatory Status RUO
Purification Method Purified
Gene Alias a730034c02; AC091465.1; DKFZp686I2148; G1-397-34; MAP 2; Map2; MAP-2; map2.S; map2a; map-2a; map2ab; MAP2B; MAP2C; MAP2R; microtubule associated protein 2; microtubule associated protein 2 S homeolog; microtubule associated protein 2; microtubule-associated protein 2; microtubule associated protein 2C; microtubule-associated protein 2; microtubule-associated protein-2; Mtap2; Mtap-2; OTTHUMP00000163916; OTTHUMP00000208143; repro4; XELAEV_18047318mg; xmap2
Gene Map2
Product Type Antibody
Gene ID (Entrez) 17756, 25595, 4133
Formulation PBS with 0.1% sodium azide; pH 7.4
Immunogen MAPs.
Classification Monoclonal
Primary or Secondary Primary
Clone M13
11

Invitrogen™ SARS-CoV-2 Spike Protein (RBD) Recombinant Human Monoclonal Antibody (T01KHu)

Human Recombinant Monoclonal Antibody

EDGE ENCOMPASS_PREFERRED
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Target Species Virus
Host Species Human
Conjugate Unconjugated
Applications ELISA,Flow Cytometry,Neutralization,Luminex,Immunocytochemistry
Form Liquid
Isotype IgG1 κ
Concentration 0.5 mg/mL
Antigen SARS-CoV-2 Spike Protein (RBD)
Regulatory Status RUO
Purification Method Protein A
Gene Alias Coronavirus; COVID; Covid 19; COVID19; COVID-19; SARS; SARS Coronavirus; SARS CoV; SARS CoV2; SARS CoV-2; SARS Spike Protein; SARS-CoV2; SARS-CoV-2
Product Type Antibody
Formulation PBS with 0.09% sodium azide; pH 7.4
Immunogen This antibody was developed using computationally derived variants of SARS-CoV antibody structures and is shown to bind Spike Protein S1 subunit (RBD) of SARS CoV2.
Classification Recombinant Monoclonal
Primary or Secondary Primary
Clone T01KHu
12

Invitrogen™ Human Serum Albumin Recombinant Rabbit Monoclonal Antibody (101)

Rabbit Recombinant Monoclonal Antibody

Content And Storage Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles.
Target Species Human
Host Species Rabbit
Conjugate Unconjugated
Applications ELISA,Flow Cytometry,Immunoprecipitation,Western Blot,Immunocytochemistry
Form Liquid
Gene Accession No. P02768
Isotype IgG
Concentration 1 mg/mL
Antigen Human Serum Albumin
Gene Symbols ALB
Regulatory Status RUO
Purification Method Protein A
Gene Alias Alb; Alb1; Alb-1; albumin; albumin (32 AA); albumin (AA 34); albumin 1; Albza; ANALBA; cell growth inhibiting protein 42; DKFZp779N1935; FDAH; GIG20; GIG42; growth-inhibiting protein 20; PRO0883; PRO0903; PRO1341; PRO1708; PRO2044; PRO2619; PRO2675; Serum albumin; UNQ696/PRO1341
Gene ALB
Product Type Antibody
Gene ID (Entrez) 213
Formulation PBS with no preservative; pH 6
Immunogen Human Serum Albumin/HSA.
Classification Recombinant Monoclonal
Primary or Secondary Primary
Clone 101
13

Invitrogen™ Glofitamab Humanized Recombinant Human Monoclonal Antibody

Human Recombinant Monoclonal Antibody

Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Target Species Human
Host Species Human
Conjugate Unconjugated
Applications ELISA,SDS-Page
Form Liquid
Isotype IgG1 κ,IgG1 λ
Concentration 1.69 mg/mL
Antigen Glofitamab Humanized
Regulatory Status RUO
Purification Method Protein A/G
Gene Alias RG-6026
Product Type Antibody
Formulation PBS with no preservative; pH 7.5
Immunogen Human CD3E/MS4A1.
Classification Recombinant Monoclonal
Primary or Secondary Primary
14

Recoverin Antibody, Novus Biologicals™
SDP

Rabbit Polyclonal Antibody

Content And Storage Store at -20°C. Avoid freeze-thaw cycles.
Target Species Human,Mouse,Rat
Host Species Rabbit
Conjugate Unconjugated
Applications ELISA,Immunohistochemistry,Western Blot,Immunohistochemistry (Paraffin),Immunocytochemistry/Immunofluorescence
Form Purified
Isotype IgG
Research Discipline Neuroscience, Vision
Antigen Recoverin
Regulatory Status RUO
Purification Method Affinity purified
Dilution Western Blot 1:500 - 1:2000, ELISA, Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1:10 - 1:100, Immunohistochemistry-Paraffin 1:50 - 1:200
Gene Alias cancer associated retinopathy antigen, Protein CAR, RCV1Cancer-associated retinopathy protein, recoverin
Gene ID (Entrez) 5957
Formulation PBS (pH 7.3), 50% glycerol
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-200 of human Recoverin (NP_002894.1).,, Sequence:, MGNSKSGALSKEILEELQLNTKFSEEELCSWYQSFLKDCPTGRITQQQFQSIYAKFFPDTDPKAYAQHVFRSFDSNLDGTLDFKEYVIALHMTTAGKTNQKLEWAFSLYDVDGNGTISKNEVLEIVMAIFKMITPEDVKLLPDDENTPEKRAEKIWKYFGKNDDDKLTEKEFIEGTLANKEILRLIQFEPQKVKEKMKNA
Classification Polyclonal
Primary or Secondary Primary
15

Human Midkine Antibody, R&D Systems™
GREENER_CHOICE

Goat Polyclonal Antibody has been used in 5 publications