Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
AKR1C2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$487.50
Specifications
| Antigen | AKR1C2 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
AKR1C2 Polyclonal specifically detects AKR1C2 in Human samples. It is validated for Western Blot.Specifications
| AKR1C2 | |
| Polyclonal | |
| Rabbit | |
| P52895 | |
| 1646 | |
| Synthetic peptide directed towards the N terminal of human AKR1C2 (NP_995317). Peptide sequence: LEAVKLAIEAGFHHIDSAHVYNNEEQVGLAIRSKIADGSVKREDIFYTSK | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| aldo-keto reductase family 1 member C2, aldo-keto reductase family 1, member C2 (dihydrodiol dehydrogenase 2; bile acidbinding protein; 3-alpha hydroxysteroid dehydrogenase, type III), BABP, Chlordecone reductase homolog HAKRD, DD, DD-2, DD2DD/BABP, DDH2FLJ53800, Dihydrodiol dehydrogenase 2, Dihydrodiol dehydrogenase/bile acid-binding protein, EC 1.1.1,3-alpha-HSD3, EC 1.1.1.213, EC 1.3.1.20, HAKRDAKR1C-pseudo, HBAB, MCDR2, pseudo-chlordecone reductase, Trans-1,2-dihydrobenzene-1,2-diol dehydrogenase, type II dihydrodiol dehydrogenase, Type III 3-alpha-hydroxysteroid dehydrogenase | |
| AKR1C2 | |
| IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
AKR1C2 Antibody, Novus Biologicals™