HTR2A Polyclonal Antibody, Invitrogen™

Rabbit Polyclonal Antibody

Supplier:  Thermo Scientific PA595288

Catalog No. PIPA595288

Description

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL.

In platelets and gut, serotonin plays a major role in cardiovascular function and motility of the gastrointestinal tract, respectively. Serotonin mediates its effects through several of G protein coupled receptors, designated 5-HT receptors or alternatively SR receptors. The SR-2 receptors are comprised of three subtypes, SR-2A, SR-2B and SR-2C, which activate phospholipase C and release intracellular stores of calcium in response to serotonin. SR-2A has a specific role in tracheal smooth muscle contraction, bronchoconstriction and mediating aldosterone production, and it is also thought to play a role in several psychiatric disorders, including depression and schizophrenia. SR-2B is expressed in embryonic and adult cardiovascular tissues, gut and brain and plays an important role in the pathology of cardiac disorders. SR-2C is thought to mediate the effects of atypical antipsychotic drugs.

Specifications

• Antigen: HTR2A
• Classification: Polyclonal
• Conjugate: Unconjugated
• Gene: Htr2a
• Gene Alias: 5-HT-2, 5Ht-2, 5-HT2 receptor, 5-HT2A, 5-HT-2A, 5HT2A Receptor, 5-HT2A receptor, 5-HT2A/2C, 5-HT2A/2C receptor, 5-hydroxytryptamine (serotonin) receptor 2A, 5-hydroxytryptamine (serotonin) receptor 2A, G protein-coupled, 5-hydroxytryptamine 2 receptor, 5-hydroxytryptamine receptor 2A, E030013E04, Htr2, Htr-2, HTR2A, serotonin 5HT-2 receptor, serotonin 5-HT-2A receptor, serotonin receptor 2A, SR2A
• Host Species: Rabbit
• Purification Method: Affinity chromatography
• Regulatory Status: RUO
• Gene ID (Entrez): 29595, 3356
• Content And Storage: Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles.
• Form: Lyophilized

• Applications: Immunohistochemistry (Paraffin), Western Blot
• Concentration: 500 μg/mL
• Formulation: PBS with 5MG BSA and 0.05MG sodium azide
• Gene Accession No.: P14842, P28223
• Gene Symbols: Htr2a
• Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human 5HT2A Receptor (400-431aa KENKKPLQLILVNTIPALAYKSSQLQMGQKKN) .
• Quantity: 100 μg
• Primary or Secondary: Primary
• Target Species: Human, Rat
• Product Type: Antibody
• Isotype: IgG