Kv6.1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP181572

Catalog No. NBP181572

Description

Kv6.1 Polyclonal specifically detects Kv6.1 in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

• Antigen: Kv6.1
• Classification: Polyclonal
• Dilution: Western Blot 0.4 ug/ml, Immunohistochemistry 1:10-1:500, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:200-1:500
• Gene Alias: KCNG, KH2, kH2K13, KV6.1, MGC12878, potassium channel KH2, potassium channel Kv6.1, potassium voltage-gated channel subfamily G member 1, potassium voltage-gated channel, subfamily G, member 1, Voltage-gated potassium channel subunit Kv6.1
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 3755
• Target Species: Human, Mouse, Rat
• Isotype: IgG

• Applications: Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: KCNG1
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:MTLLPGDNSDYDYSALSCTSDASFHPAFLPQRQAIKGAFY
• Quantity: 0.1 mL
• Primary or Secondary: Primary
• Test Specificity: Specificity of human Kv6.1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Research Use Only