KvBeta2 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP310368100UL

Catalog No. NB125637

Description

KvBeta2 Polyclonal specifically detects KvBeta2 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: KvBeta2
• Classification: Polyclonal
• Dilution: Western Blot 1.0 ug/ml
• Gene Alias: HKvbeta2, HKvbeta2.1, HKvbeta2.2, K(+) channel subunit beta-2, K+ channel beta-2 subunit, KCNA2BAKR6A5, KCNK2, KV-BETA-2, MGC117289, potassium channel shaker chain beta 2, potassium voltage-gated channel, shaker-related subfamily, beta member 2, voltage-gated potassium channel subunit beta-2
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human KvBeta2. Peptide sequence KIFWGGKAETERGLSRKHIIEGLKASLERLQLEYVDVVFANRPDPNTPME
• Quantity: 100 μg
• Research Discipline: Signal Transduction
• Gene ID (Entrez): 8514
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Conjugate: Unconjugated
• Formulation: PBS buffer, 2% sucrose
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human
• Form: Purified