Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
POLR2F Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP181714
Description
POLR2F Polyclonal specifically detects POLR2F in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.Specifications
POLR2F | |
Polyclonal | |
Western Blot 0.4 ug/ml, Immunohistochemistry 1:10-1:500, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:50-1:200 | |
DNA-directed RNA polymerase II subunit F, DNA-directed RNA polymerases I, II, and III 14.4 kDa polypeptide, HRBP14.4, II, and III subunit RPABC2, polymerase (RNA) II (DNA directed) polypeptide F, RNA Polymerase II subunit 14.4 kD, RNA polymerases I, II, and III subunit ABC2, RPB6, RPB6 homolog | |
Rabbit | |
Affinity Purified | |
RUO | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
Unconjugated | |
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
POLR2F | |
This antibody was developed against Recombinant Protein corresponding to amino acids:GDDFDDVEEDEGLDDLENAEEEGQENVEILPSGERPQANQKRITTPYMTKYERARVLGTRALQIAMCAPVMVELEGETDPLLIAMKELKARKIPIIIRRYLPDGSYEDWGVDELII | |
0.1 mL | |
Core ESC Like Genes, Stem Cell Markers | |
5435 | |
Human | |
IgG |
Product Suggestions
Customers who viewed this item also viewed
Viewing 1-4 of
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
POLR2F Antibody, Novus Biologicals™ > 0.1mL; Unlabeled
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction