Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Protocadherin 21 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier: Novus Biologicals NBP192296

Catalog No. NBP192296

$648.50 / Each of 1

Already have an account? Sign In to view your price. New here? Register with us today!

Qty

Add to Cart

Description

Protocadherin 21 Polyclonal specifically detects Protocadherin 21 in Human, Rat samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin, Immunohistochemistry-Frozen.

Specifications

Antigen	Protocadherin 21
Classification	Polyclonal
Dilution	Immunohistochemistry 1:500 - 1:1000, Immunohistochemistry-Paraffin 1:500 - 1:1000, Immunohistochemistry-Frozen
Gene Alias	cadherin-related family member 1, CORD15, KIAA1775DKFZp434A132, PCDH21MT-protocadherin, Photoreceptor cadherin, prCAD, PRCADprotocadherin-21, protocadherin 21, Protocadherin-21
Host Species	Rabbit
Purification Method	Affinity Purified
Regulatory Status	RUO
Gene ID (Entrez)	92211
Target Species	Human, Rat
Isotype	IgG

Applications	Immunohistochemistry, Immunohistochemistry (Paraffin), Immunohistochemistry (Frozen)
Conjugate	Unconjugated
Formulation	PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Symbols	CDHR1
Immunogen	This antibody was developed against Recombinant Protein corresponding to amino acids:TPYYGYVYEDTLPGSEVLKVVAMDGDRGKPNRILYSLVNGNDGAFEINETSGAISITQSPAQLQREVYELHVQVTE
Quantity	0.1 mL
Primary or Secondary	Primary
Test Specificity	Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage	Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Product Suggestions

Customers who viewed this item also viewed This information does not imply a recommendation or representation of any kind and any action taken upon the information provided is strictly at your own risk. The products shown have not been qualified by Fisher Scientific for any particular purpose, application or use and it is the responsibility of the purchaser to ensure that the performance of the product is suitable for the purchasers specific use or intended application.

Viewing 1-5 of 8

Catalog No. PI23209

Thermo Scientific ™ Pierce ™ Bovine Serum Alb Thermo Scientific ™ Pierce ™ Bovine Serum Alb

$107.65 / Pack of 10

Save 34% Reg: $161.90
Catalog No. BP1600-100

Fisher BioReagents ™ Bovine Serum Albumin, Hea Fisher BioReagents ™ Bovine Serum Albumin, Hea

$480.00 - $2320.00
Catalog No. PI23227

Thermo Scientific ™ Pierce ™ BCA Protein Assa Thermo Scientific ™ Pierce ™ BCA Protein Assa

$186.65 / Each

Save 31% Reg: $272.00
Catalog No. PI89900

Thermo Scientific ™ RIPA Lysis and Extraction Thermo Scientific ™ RIPA Lysis and Extraction

$225.50 / Each
Catalog No. PI78440

Thermo Scientific ™ Halt ™ Protease and Phosp Thermo Scientific ™ Halt ™ Protease and Phosp

$411.50 / Each
Catalog No. PI87786

Thermo Scientific ™ Halt ™ Protease Inhibitor Thermo Scientific ™ Halt ™ Protease Inhibitor

$221.00 / Each
Catalog No. PI34028

Thermo Scientific ™ 1-Step ™ TMB ELISA Substr Thermo Scientific ™ 1-Step ™ TMB ELISA Substr

$224.65 / Each

Save 29% Reg: $318.00
Catalog No. BDB564220

Fc Block , Unlabeled, Clone: 3070, BD Fc Block , Unlabeled, Clone: 3070, BD

$198.00 / Each

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Protocadherin 21 Antibody, Novus Biologicals™ > 0.1mL; Unlabeled

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Your feedback has been submitted: Thank you for helping us improve our website.

For Research Use Only

Spot an opportunity for improvement?Share a Content Correction

Protocadherin 21 Antibody, Novus Biologicals™

Description

Specifications

Product Suggestions

Documents

Promotions