TXNDC5 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP21349625UL

Catalog No. NB438488

Description

TXNDC5 Polyclonal specifically detects TXNDC5 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: TXNDC5
• Classification: Polyclonal
• Dilution: Western Blot 0.4 ug/ml, Immunohistochemistry 1:2500 - 1:5000, Immunohistochemistry-Paraffin 1:2500 - 1:5000
• Gene Alias: ENDOPDI, ERP46, FLJ90810, HCC-2, member 15, MGC3178, PDIA15, thioredoxin domain containing 5, thioredoxin domain containing 5 (endoplasmic reticulum), thioredoxin domain-containing protein 5, thioredoxin related protein, TLP46
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: TXNDC5
• Immunogen: This antibody was developed against a recombinant protein corresponding to the amino acids: TLENWMLQTLNEEPVTPEPEVEPPSAPELKQGLYELSASNFELHVAQGDHFIKFFAPWCGHCKALAPTWEQLALGLEHSETVKIGKVDC
• Quantity: 25ul
• Research Discipline: Apoptosis
• Gene ID (Entrez): 81567
• Target Species: Human
• Isotype: IgG

For Research Use Only