Primary Antibodies

Primary antibodies are immunoglobulins that recognize and bind to a specific antigen of interest with high affinity and specificity to purify, detect, and measure that antigen. Includes antibody pairs for specific biochemical applications.

451 – 465 of 1,444,027 results

451

Invitrogen™ Phospho-CRYAB (Ser45) Polyclonal Antibody

Rabbit Polyclonal Antibody

Pricing & Availability
Specifications

Content And Storage	-20°C, Avoid Freeze/Thaw Cycles
Target Species	Human,Mouse,Rat,Bovine
Host Species	Rabbit
Conjugate	Unconjugated
Applications	Immunohistochemistry (Paraffin),Western Blot
Form	Lyophilized
Gene Accession No.	P02510, P02511, P23927, P23928
Isotype	IgG
Concentration	1 mg/mL
Antigen	Phospho-CRYAB (Ser45)
Gene Symbols	Cryab
Regulatory Status	RUO
Purification Method	Antigen affinity chromatography
Gene Alias	2310001E10Rik; 3526402H21Rik; AACRYA; active transcription factor CREB; alpha B-crystallin; alpha crystallin B; alpha(B)-crystallin; alpha-B-crystallin; Alpha-crystallin B chain; alpha-crystallin B chain-like protein; AV083133; cAMP response element binding protein 1; cAMP responsive element binding protein 1; cAMP-response element-binding protein-1; cAMP-responsive element-binding protein 1; CMD1II; CREB; CREB1; CREB-1; Crya2; Crya-2; CRYAB; CryAB antibody; crystallin alpha B; crystallin, alpha 2; crystallin, alpha B; crystallin, alpha polypeptide 2; CTPP2; CTRCT16; cyclic adenosine 3',5'-monophosphate response element-binding protein CREB; cyclic AMP-responsive element-binding protein 1; epididymis secretory protein Li 101; heat shock protein beta-5; heat shock protein CryAB; heat shock protein HspB5; heat-shock 20 kD like-protein; HEL-S-101; HSPB5; HspB5 protein; MFM2; P23; Renal carcinoma antigen NY-REN-27; rosenthal fiber component; transactivator protein; Y protein
Gene	Cryab
Product Type	Antibody
Gene ID (Entrez)	12955, 1410, 25420, 281719
Formulation	PBS with 30mg/mL BSA and 0.05% sodium azide
Immunogen	Synthetic phopshopeptide corresponding to residues L(44) S(p) P F Y L R P P S F(54) C of human alpha-B Crystallin.
Classification	Polyclonal
Primary or Secondary	Primary

452

Invitrogen™ Leptin Polyclonal Antibody

Rabbit Polyclonal Antibody

Pricing & Availability
Specifications

Content And Storage	-20°C, Avoid Freeze/Thaw Cycles
Target Species	Human,Mouse,Pig
Host Species	Rabbit
Conjugate	Unconjugated
Applications	Western Blot,Immunocytochemistry
Form	Liquid
Gene Accession No.	P41159, P41160, Q29406
Isotype	IgG
Antigen	Leptin
Gene Symbols	Lep
Regulatory Status	RUO
Purification Method	Ammonium sulfate precipitation
Gene Alias	CD295 antigen; H-Leptin; HuB219; Lep; LEPD; LEP-R; Leptin; leptin (murine obesity homolog); leptin (obesity homolog, mouse); leptin precursor; Method: conceptual translation supplied by author.; OB; obese; obese protein; obese, mouse, homolog of; obesity; obesity factor; obesity protein; OB-R; OBS; truncated leptin
Gene	Lep
Product Type	Antibody
Gene ID (Entrez)	16846, 3952, 396832
Formulation	PBS with 0.05% sodium azide
Immunogen	Synthetic peptide corresponding to residues S(91) R N V I Q I S N D L E N L R D(106) of human Leptin.
Classification	Polyclonal
Primary or Secondary	Primary

453

Invitrogen™ COL4A1 Recombinant Rabbit Monoclonal Antibody (HL1351)

Rabbit Recombinant Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles.
Target Species	Human,Mouse
Host Species	Rabbit
Conjugate	Unconjugated
Applications	Immunohistochemistry (Paraffin),Western Blot,Immunocytochemistry
Form	Liquid
Gene Accession No.	P02462, P02463
Isotype	IgG
Concentration	1 mg/mL
Antigen	COL4A1
Gene Symbols	COL4A1
Regulatory Status	RUO
Purification Method	Protein A
Gene Alias	alpha 1 type IV collagen; alpha1(IV) collagen; arresten; Bru; BSVD; COL4A1; Col4a-1; COL4A1 NC1 domain; collagen alpha-1(IV) chain; collagen IV, alpha-1 polypeptide; collagen of basement membrane, alpha-1 chain; collagen type IV alpha 1 chain; collagen, type IV, alpha 1; Del(8)44H; Del(8)Bru44H; procollagen, type IV, alpha 1; RATOR; Raw; retinal anterior wiring; Svc
Gene	COL4A1
Product Type	Antibody
Gene ID (Entrez)	1282, 12826
Formulation	PBS with no preservative
Immunogen	Recombinant protein encompassing a sequence within the N-terminus of human COL4A1. The exact sequence is proprietary.
Classification	Recombinant Monoclonal
Primary or Secondary	Primary
Clone	HL1351

454

Invitrogen™ SMARCA2 Recombinant Rabbit Monoclonal Antibody (HL1115)

Rabbit Recombinant Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles.
Target Species	Human,Mouse,Rat
Host Species	Rabbit
Conjugate	Unconjugated
Applications	Immunohistochemistry (Paraffin),Western Blot,Immunocytochemistry
Form	Liquid
Gene Accession No.	P51531, Q6DIC0
Isotype	IgG
Concentration	1 mg/mL
Antigen	SMARCA2
Gene Symbols	SMARCA2
Regulatory Status	RUO
Purification Method	Protein A
Gene Alias	2610209L14Rik; ATP-dependent helicase SMARCA2; BAF190; Baf190b; brahma; BRG1-associated factor 190B; BRM; FLJ36757; global transcription activator homologous sequence; hBRM; hSNF2a; MGC74511; NCBRS; Probable global transcription activator SNF2L2; protein brahma homolog; SMARCA2; SNF2; SNF2/SWI2-like protein 2; SNF2A; SNF2alpha; SNF2-alpha; Snf2l2; SNF2LA; Sth1p; subunit of the SWI/SNF chromatin remodeling complex; sucrose nonfermenting 2-like protein 2; SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily a, member 2; SWI/SNF-related matrix-associated actin-dependent regulator of chromatin a2; SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 2; SWI2
Gene	SMARCA2
Product Type	Antibody
Gene ID (Entrez)	361745, 6595, 67155
Formulation	PBS with no preservative
Immunogen	Carrier-protein conjugated synthetic peptide encompassing a sequence within the N-terminus region of human SMARCA2. The exact sequence is proprietary.
Classification	Recombinant Monoclonal
Primary or Secondary	Primary
Clone	HL1115

455

Invitrogen™ IL-18 Recombinant Rabbit Monoclonal Antibody (HL1859)

Rabbit Recombinant Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles.
Target Species	Human,Mouse
Host Species	Rabbit
Conjugate	Unconjugated
Applications	Immunohistochemistry (Paraffin),Western Blot,Immunocytochemistry
Form	Liquid
Gene Accession No.	P70380, Q14116
Isotype	IgG
Concentration	1 mg/mL
Antigen	IL-18
Gene Symbols	IL18
Regulatory Status	RUO
Purification Method	Protein A
Gene Alias	cytokine; iboctadekin; IFN-gamma-inducing factor; IGIF; il 18; IL-1 gamma; IL18; IL-18; IL1F4; IL-1g; ILN; interferon gamma inducing factor; interferon gamma-inducing factor; interferon-gamma-inducing factor; Interleukin; interleukin 18; interleukin 18 (interferon-gamma-inducing factor); interleukin-1 gamma; Interleukin18; Interleukin-18; interleukin-18 proprotein; interleukin-18-like protein; MGC12320
Gene	IL18
Product Type	Antibody
Gene ID (Entrez)	16173, 3606
Formulation	PBS with no preservative
Immunogen	Recombinant fragment of mouse IL18.
Classification	Recombinant Monoclonal
Primary or Secondary	Primary
Clone	HL1859

456

Invitrogen™ GM130 Polyclonal Antibody, Alexa Fluor™ 647

Rabbit Polyclonal Antibody

Pricing & Availability
Specifications

Content And Storage	4°C, store in dark, DO NOT FREEZE!
Target Species	Human
Host Species	Rabbit
Conjugate	Alexa Fluor 647
Applications	Immunocytochemistry
Form	Liquid
Gene Accession No.	Q08379
Isotype	IgG
Concentration	1 mg/mL
Antigen	GM130
Gene Symbols	Golga2
Regulatory Status	RUO
Purification Method	Antigen affinity chromatography
Gene Alias	130 kDa cis-Golgi matrix protein; AW555139; cis-Golgi matrix protein GM130; Gm130; GM130 autoantigen; GOLGA2; golgi autoantigen, golgin subfamily a, 2; Golgi matrix protein GM130; golgin A2; Golgin subfamily A member 2; Golgin subfamily A member 2; LOW QUALITY PROTEIN: golgin subfamily A member 2; golgin-95; mKIAA4150; RP11-395P17.5; SY11 protein
Gene	Golga2
Product Type	Antibody
Gene ID (Entrez)	2801
Formulation	PBS with 1mg/mL BSA and 0.05% sodium azide; pH 7.4
Immunogen	Synthetic peptide corresponding to residues G(368) Q V M E S V R Q L Q M E R D K(383) of human GM130.
Classification	Polyclonal
Primary or Secondary	Primary

457

Invitrogen™ GRP78 Polyclonal Antibody, Alexa Fluor™ 647

Rabbit Polyclonal Antibody

Pricing & Availability
Specifications

Content And Storage	4°C, store in dark, DO NOT FREEZE!
Target Species	Human,Mouse,Rat
Host Species	Rabbit
Conjugate	Alexa Fluor 647
Applications	Immunocytochemistry
Form	Liquid
Gene Accession No.	P06761, P11021, P20029
Isotype	IgG
Concentration	1 mg/mL
Antigen	GRP78
Gene Symbols	Hspa5
Regulatory Status	RUO
Purification Method	Antigen affinity chromatography
Gene Alias	78 kDa glucose-regulated protein; 78 kDa glucose-regulated protein homolog; 78-kD glucose-regulated protein precursor; AL022860; AU019543; baffled; Binding-immunoglobulin protein; bip; BiP protein; BiP/Grp78; cb865; D2Wsu141e; D2Wsu17e; Endoplasmic reticulum chaperone BiP; endoplasmic reticulum chaperone BiP; 78 kDa glucose-regulated protein; endoplasmic reticulum lumenal Ca(2+)-binding protein grp78; epididymis secretory sperm binding protein Li 89n; fb60h09; fi36d04; FLJ26106; glucose regulated protein, 78 kDa; glucose-regulated protein; glucose-regulated protein, 78kDa; GRP 78; grp78; GRP-78; heat shock 70 kDa protein 5; heat shock 70 kDa protein 5a; heat shock 70kD protein 5; heat shock 70kD protein 5 (glucose-regulated protein, 78kD); heat shock 70kDa protein 5; heat shock 70kDa protein 5 (glucose-regulated protein); heat shock 70kDa protein 5 (glucose-regulated protein, 78kDa); heat shock protein 5; heat shock protein 70 family protein 5; heat shock protein family A (Hsp70) member 5; heat shock protein family A (Hsp70) member 5 L homeolog; heat shock protein family A member 5; heavy-chain binding protein BiP; HEL-S-89n; Hsce70; hsp70; Hsp70 family ATPase KAR2; HSP70 family protein 5; HSPA 5; HSPA5; hspa5.L; hspa5a; I79_019946; immunoglobulin binding protein; immunoglobulin heavy chain-binding protein; Immunoglobulin heavy chain-binding protein homolog; J1248; KAR2; mBiP; MIF2; Sez7; SEZ-7; SSD1; Steroidogenesis-activator polypeptide; wu:fb60h09; wu:fi36d04; XAP-1; XAP-1 antigen; XELAEV_180384511mg; YJL034W; zgc:55994; zgc:77606
Gene	Hspa5
Product Type	Antibody
Gene ID (Entrez)	14828, 25617, 3309
Formulation	PBS with 1mg/mL BSA and 0.05% sodium azide; pH 7.4
Immunogen	Synthetic peptide corresponding to residues C T(643) G E E D T S E K D E L(654) of rat GRP78.
Classification	Polyclonal
Primary or Secondary	Primary

458

Invitrogen™ CD90 Recombinant Rabbit Monoclonal Antibody (HL1766)

Rabbit Recombinant Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles.
Target Species	Human,Mouse,Rat
Host Species	Rabbit
Conjugate	Unconjugated
Applications	Immunohistochemistry (Paraffin),Western Blot,Immunocytochemistry
Form	Liquid
Gene Accession No.	P01830, P01831, P04216
Isotype	IgG
Concentration	1 mg/mL
Antigen	CD90
Gene Symbols	Thy1
Regulatory Status	RUO
Purification Method	Protein A
Gene Alias	CD7; CD90; CDw90; FLJ33325; membrane glycoprotein; T25; Thy 1.2; THY1; Thy-1; Thy-1 antigen; Thy-1 cell surface antigen; thy-1 glycoprotein; thy-1 membrane glycoprotein; Thy-1 protein; Thy-1 T-cell antigen; Thy1.1; Thy1.2; Thy-1.2; thymus cell antigen 1, theta; Thymus cell surface antigen
Gene	Thy1
Product Type	Antibody
Gene ID (Entrez)	21838, 24832, 7070
Formulation	PBS with no preservative
Immunogen	Recombinant protein encompassing a sequence within the center region of human CD90. The exact sequence is proprietary.
Classification	Recombinant Monoclonal
Primary or Secondary	Primary
Clone	HL1766

459

Invitrogen™ C-Peptide Recombinant Rabbit Monoclonal Antibody (HL1159)

Rabbit Recombinant Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles.
Target Species	Human,Mouse,Rat
Host Species	Rabbit
Conjugate	Unconjugated
Applications	ELISA,Immunohistochemistry (Paraffin)
Form	Liquid
Gene Accession No.	P01308, P01322, P01325
Isotype	IgG
Concentration	1 mg/mL
Antigen	C-Peptide
Gene Symbols	INS, Ins1
Regulatory Status	RUO
Purification Method	Protein A
Gene Alias	Cpeptide; IDDM; IDDM1; IDDM2; ILPR; INS; Ins1; Ins-1; Ins2-rs1; insulin; insulin 1; Insulin A chain; Insulin B chain; insulin I; insulin-1; Insulin-1 A chain; Insulin-1 B chain; IRDN; MODY10; preproinsulin; proinsulin
Gene	INS
Product Type	Antibody
Gene ID (Entrez)	16333, 24505, 3630
Formulation	PBS with no preservative
Immunogen	Synthetic peptide corresponding to human c-peptide.
Classification	Recombinant Monoclonal
Primary or Secondary	Primary
Clone	HL1159

460

Invitrogen™ Influenza A H5N8 HA (A/Astrakhan/3212/2020) Recombinant Rabbit Monoclonal Antibody (HL1550)

Rabbit Recombinant Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles.
Target Species	Virus
Host Species	Rabbit
Conjugate	Unconjugated
Applications	Immunohistochemistry (Paraffin),Western Blot
Form	Liquid
Isotype	IgG
Concentration	1 mg/mL
Antigen	Influenza A H5N8 HA (A/Astrakhan/3212/2020)
Regulatory Status	RUO
Purification Method	Protein A
Gene Alias	flu hemagglutinin; influenza hemagglutinin
Product Type	Antibody
Formulation	PBS with no preservative
Immunogen	Recombinant protein encompassing a sequence within the center region of Influenza A virus H5N8 HA (Hemagglutinin)(A/Astrakhan/3212/2020)). The exact sequence is proprietary.
Classification	Recombinant Monoclonal
Primary or Secondary	Primary
Clone	HL1550

461

Invitrogen™ Flavivirus Envelope Chimeric Recombinant Rabbit Monoclonal Antibody (D1-4G2-4-15 (4G2))

Rabbit Recombinant Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles.
Target Species	Virus
Host Species	Rabbit
Conjugate	Unconjugated
Applications	ELISA,Flow Cytometry,Immunohistochemistry (Paraffin),Neutralization,Western Blot,Immunocytochemistry
Form	Liquid
Gene Accession No.	P05556
Isotype	IgG κ
Concentration	1 mg/mL
Antigen	Flavivirus Envelope Chimeric
Regulatory Status	RUO
Purification Method	Protein A
Gene	ITGB1
Product Type	Antibody
Gene ID (Entrez)	3688
Formulation	PBS with 0.02% ProClin 300
Immunogen	Dengue Virus type 2 antigens.
Classification	Recombinant Monoclonal
Primary or Secondary	Primary
Clone	D1-4G2-4-15 (4G2)

462

Invitrogen™ RAB11A Monoclonal Antibody (4H9)

Mouse Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	-20°C
Target Species	Human,Mouse,Rat
Host Species	Mouse
Conjugate	Unconjugated
Applications	Flow Cytometry,Immunohistochemistry (Paraffin),Western Blot,Immunocytochemistry
Form	Lyophilized
Gene Accession No.	P62491, P62492, P62494
Isotype	IgG2b
Concentration	500 μg/mL
Antigen	RAB11A
Gene Symbols	RAB11A
Regulatory Status	RUO
Purification Method	Antigen affinity chromatography
Gene Alias	24KG; RAB 11A, member oncogene family; RAB11; rab-11; rab11 GTP-binding protein; Rab11a; RAB11a, member RAS oncogene family; ras-related protein Rab-11A; tubulovesicle-associated protein; YL8
Gene	RAB11A
Product Type	Antibody
Gene ID (Entrez)	53869, 81830, 8766
Formulation	PBS with 4mg trehalose and no preservative
Immunogen	A synthetic peptide corresponding to a sequence at the C-terminus of human Rab11A (171-211aa EIYRIVSQKQMSDRRENDMSPSNNVVPIHVPPTTENKPKVQ).
Classification	Monoclonal
Primary or Secondary	Primary
Clone	4H9

463

Invitrogen™ FOXP3 Polyclonal Antibody

Rabbit Polyclonal Antibody

Pricing & Availability
Specifications

Content And Storage	-20°C, Avoid Freeze/Thaw Cycles
Target Species	Human
Host Species	Rabbit
Conjugate	Unconjugated
Applications	ChIP Assay,Western Blot,Immunocytochemistry
Form	Liquid
Gene Accession No.	Q9BZS1
Isotype	IgG
Concentration	1 mg/mL
Antigen	FOXP3
Gene Symbols	Foxp3
Regulatory Status	RUO
Purification Method	Antigen Affinity Chromatography
Gene Alias	AIID; DIETER; forkhead box P3; forkhead box protein P3; Forkhead box protein P3 41 kDa form; Forkhead box protein P3, C-terminally processed; forkhead/winged helix transcription factor 3; Foxp3; FOXP3delta7; immune dysregulation, polyendocrinopathy, enteropathy, X-linked; immunodeficiency, polyendocrinopathy, enteropathy, X-linked; IPEX; JM2; MGC141961; MGC141963; PIDX; regulatory protein Foxp3; RGD1562112; RP23-54C14.1; scurfin; scurfy; sf; XPID
Gene	Foxp3
Product Type	Antibody
Gene ID (Entrez)	50943
Formulation	PBS with 1mg/mL BSA and 0.05% sodium azide
Immunogen	Synthetic peptide corresponding to residues W(406) T V D E L E F R K K R S Q R(420) of human FOXP3.
Classification	Polyclonal
Primary or Secondary	Primary

464

Invitrogen™ GATA4 Polyclonal Antibody

Rabbit Polyclonal Antibody

Pricing & Availability
Specifications

Content And Storage	-20°C
Target Species	Human,Mouse
Host Species	Rabbit
Conjugate	Unconjugated
Applications	Flow Cytometry,Immunohistochemistry (Paraffin),Western Blot,Immunocytochemistry
Form	Liquid
Gene Accession No.	P43694, Q08369
Isotype	IgG
Concentration	1 mg/mL
Antigen	GATA4
Gene Symbols	GATA4
Regulatory Status	RUO
Purification Method	Antigen affinity chromatography
Gene Alias	ASD2; DNA-binding protein GATA-GT2; GAT4; GATA binding protein 4; GATA4; Gata-4; GATA-binding factor 4; GATA-binding protein 4; MGC126629; TACHD; TOF; Transcription factor GATA-4; VSD1
Gene	GATA4
Product Type	Antibody
Gene ID (Entrez)	14463, 2626
Formulation	PBS with 30% glycerol, 1mg/mL BSA and 0.05% sodium azide
Immunogen	Pooled peptides: RKEGIQTRKRKPKNLNKSK & SKQDSWNSLVLADSHGDIITA.
Classification	Polyclonal
Primary or Secondary	Primary

465

Invitrogen™ ARID2 Monoclonal Antibody (GT7311)

Mouse Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles.
Target Species	Human,Mouse
Host Species	Mouse
Conjugate	Unconjugated
Applications	Western Blot
Form	Liquid
Gene Accession No.	Q68CP9
Isotype	IgG1
Concentration	1 mg/mL
Antigen	ARID2
Gene Symbols	ARID2
Regulatory Status	RUO
Purification Method	Protein G
Gene Alias	1700124K17Rik; 4432409D24Rik; arid 2; ARID domain-containing protein 2; ARID2; AT rich interactive domain 2 (ARID, RFX-like); AT rich interactive domain 2 (Arid-rfx like); AT-rich interaction domain 2; AT-rich interactive domain-containing protein 2; Baf200; BRG1-associated factor 200; KIAA1557; p200; RFX-like; Zinc finger protein with activation potential; zipzap; zipzap/p200
Gene	ARID2
Product Type	Antibody
Gene ID (Entrez)	196528, 77044
Formulation	PBS with 20% glycerol and no preservative; pH 7
Immunogen	Recombinant protein encompassing a sequence within the C-terminus region of human ARID2. The exact sequence is proprietary.
Classification	Monoclonal
Primary or Secondary	Primary
Clone	GT7311

Prev
1
...
29
30
31
32
...
96,269
Next

Welcome to fishersci.com

Primary Antibodies

Filtered Search Results

Narrow Results

Invitrogen™ Phospho-CRYAB (Ser45) Polyclonal Antibody Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ Leptin Polyclonal Antibody Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ COL4A1 Recombinant Rabbit Monoclonal Antibody (HL1351) Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ SMARCA2 Recombinant Rabbit Monoclonal Antibody (HL1115) Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ IL-18 Recombinant Rabbit Monoclonal Antibody (HL1859) Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ GM130 Polyclonal Antibody, Alexa Fluor™ 647 Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ GRP78 Polyclonal Antibody, Alexa Fluor™ 647 Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ CD90 Recombinant Rabbit Monoclonal Antibody (HL1766) Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ C-Peptide Recombinant Rabbit Monoclonal Antibody (HL1159) Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ Influenza A H5N8 HA (A/Astrakhan/3212/2020) Recombinant Rabbit Monoclonal Antibody (HL1550) Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ Flavivirus Envelope Chimeric Recombinant Rabbit Monoclonal Antibody (D1-4G2-4-15 (4G2)) Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ RAB11A Monoclonal Antibody (4H9) Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ FOXP3 Polyclonal Antibody Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ GATA4 Polyclonal Antibody Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ ARID2 Monoclonal Antibody (GT7311) Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ Phospho-CRYAB (Ser45) Polyclonal Antibody

Invitrogen™ Leptin Polyclonal Antibody

Invitrogen™ COL4A1 Recombinant Rabbit Monoclonal Antibody (HL1351)

Invitrogen™ SMARCA2 Recombinant Rabbit Monoclonal Antibody (HL1115)

Invitrogen™ IL-18 Recombinant Rabbit Monoclonal Antibody (HL1859)

Invitrogen™ GM130 Polyclonal Antibody, Alexa Fluor™ 647

Invitrogen™ GRP78 Polyclonal Antibody, Alexa Fluor™ 647

Invitrogen™ CD90 Recombinant Rabbit Monoclonal Antibody (HL1766)

Invitrogen™ C-Peptide Recombinant Rabbit Monoclonal Antibody (HL1159)

Invitrogen™ Influenza A H5N8 HA (A/Astrakhan/3212/2020) Recombinant Rabbit Monoclonal Antibody (HL1550)

Invitrogen™ Flavivirus Envelope Chimeric Recombinant Rabbit Monoclonal Antibody (D1-4G2-4-15 (4G2))

Invitrogen™ RAB11A Monoclonal Antibody (4H9)

Invitrogen™ FOXP3 Polyclonal Antibody

Invitrogen™ GATA4 Polyclonal Antibody

Invitrogen™ ARID2 Monoclonal Antibody (GT7311)