CA125/MUC16 Mouse anti-Human, Clone: , Novus Biologicals™

Mouse Monoclonal Antibody

Supplier:  Novus Biologicals NBP259024

Catalog No. NBP259024

Description

CA125/MUC16 Monoclonal specifically detects CA125/MUC16 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: CA125/MUC16
• Classification: Monoclonal
• Dilution: Immunohistochemistry-Paraffin 1:500 - 1:1000
• Gene Accession No.: Q8WXI7
• Gene Symbols: MUC16
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:GVLVTTRRRKKEGEYNVQQQCPGYYQSHLDLEDLQ
• Quantity: 100 μL
• Research Discipline: Cellular Markers, Extracellular Matrix, Tumor Biomarkers
• Gene ID (Entrez): 94025
• Target Species: Human
• Form: Purified

• Applications: Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
• Gene Alias: CA-125, CA125 ovarian cancer antigen, CA125MUC-16, FLJ14303, mucin 16, cell surface associated, mucin-16, Ovarian cancer-related tumor marker CA125, Ovarian carcinoma antigen CA125
• Host Species: Mouse
• Purification Method: Protein A purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Isotype: IgG2b

For Research Use Only