Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Klkbl4 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$152.22 - $436.00
Specifications
| Antigen | Klkbl4 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP15761720
|
Novus Biologicals
NBP15761720UL |
20 μL |
Each for $152.22
|
|
NBP157617
|
Novus Biologicals
NBP157617 |
100 μL |
Each for $436.00
|
|
Description
Klkbl4 Polyclonal specifically detects Klkbl4 in Human samples. It is validated for Western Blot.Specifications
| Klkbl4 | |
| Polyclonal | |
| Rabbit | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| Cancer/testis antigen 67, CT67Plasma kallikrein-like protein 4, FLJ25339, KLKBL4inactive serine protease 54, protease, serine, 54 | |
| PRSS54 | |
| IgG | |
| Affinity Purified |
| Western Blot | |
| Unconjugated | |
| RUO | |
| Q6PEW0 | |
| 221191 | |
| Synthetic peptides corresponding to KLKBL4 The peptide sequence was selected from the C terminal of KLKBL4 (NP_001073961). Peptide sequence EASVQPLYYDYYGGEVGEGRIFAGQNRLYQPEEIILVSFVLVFFCSSI. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title