
Cell Culture Reagents, Antibiotics and Supplements
Products designed for cell culture processes including, but not limited to dissociation, decontamination, and growth stimulation.

Antibiotics
(6,417)

Cell Culture Growth Factors and Hormones
(2,276)

Additional Cell Culture Reagents and Supplements
(999)

Nutritional Supplements
(443)

Dissociation Reagents
(244)

Contaminant Detection and Removal Reagents
(54)

Growth Factor Products
(33)
Filtered Search Results
Products from some of our suppliers do not display in filtered search results. Please
clear all filters
to see these products.

1,036
–
1,050
of
9,626
results
Invitrogen™ Human NCDN (aa 624-721) Control Fragment Recombinant Protein
Recombinant Protein

Encompass Procurement Services
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Regulatory Status | RUO |
---|---|
Purity or Quality Grade | >80% by SDS-PAGE and Coomassie blue staining |
Conjugate | Unconjugated |
Form | Liquid |
Formulation | 1 M urea, PBS with no preservative; pH 7.4 |
Sequence | PEYEGIWADLQELWFLGMQAFTGCVPLLPWLAPAALRSRWPQELLQLLGSVSPNSVKPEMVAAYQGVLVELARANRLCREAMRLQAGEETASHYRMAA |
Concentration | ≥5.0 mg/mL |
For Use With (Application) | Blocking Assay,Control |
Name | Human NCDN (aa 624-721) Control Fragment |
Recombinant | Recombinant |
Invitrogen™ Human SLC10A5 (aa 96-164) Control Fragment Recombinant Protein
Recombinant Protein

Encompass Procurement Services
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Regulatory Status | RUO |
---|---|
Purity or Quality Grade | >80% by SDS-PAGE and Coomassie blue staining |
Conjugate | Unconjugated |
Form | Liquid |
Formulation | 1 M urea, PBS with no preservative; pH 7.4 |
Sequence | GETNVTIQLWDSEGRQERLIEEIKNVKVKVLKQKDSLLQAPMHIDRNILMLILPLILLNKCAFGCKIEL |
Concentration | ≥5.0 mg/mL |
For Use With (Application) | Blocking Assay,Control |
Name | Human SLC10A5 (aa 96-164) Control Fragment |
Recombinant | Recombinant |
Invitrogen™ Human eIF4G3 (aa 1119-1211) Control Fragment Recombinant Protein
Recombinant Protein

Encompass Procurement Services
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Regulatory Status | RUO |
---|---|
Purity or Quality Grade | >80% by SDS-PAGE and Coomassie blue staining |
Conjugate | Unconjugated |
Form | Liquid |
Formulation | 1 M urea, PBS with no preservative; pH 7.4 |
Sequence | EFDSRRTLTSRGSMGREKNDKPLPSATARPNTFMRGGSSKDLLDNQSQEEQRREMLETVKQLTGGVDVERNSTEAERNKTRESAKPEISAMSA |
Concentration | ≥5.0 mg/mL |
For Use With (Application) | Blocking Assay,Control |
Name | Human eIF4G3 (aa 1119-1211) Control Fragment |
Recombinant | Recombinant |
Invitrogen™ Human KAP3 (aa 596-670) Control Fragment Recombinant Protein
Recombinant Protein

Encompass Procurement Services
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Regulatory Status | RUO |
---|---|
Purity or Quality Grade | >80% by SDS-PAGE and Coomassie blue staining |
Conjugate | Unconjugated |
Form | Liquid |
Formulation | 1 M urea, PBS with no preservative; pH 7.4 |
Sequence | ELLNAQQEDDEFVCQIIYVFYQMVFHQATRDVIIKETQAPAYLIDLMHDKNNEIRKVCDNTLDIIAEYDEEWAKK |
Concentration | ≥5.0 mg/mL |
For Use With (Application) | Blocking Assay,Control |
Name | Human KAP3 (aa 596-670) Control Fragment |
Recombinant | Recombinant |
Invitrogen™ Human SCRIB (aa 445-532) Control Fragment Recombinant Protein
Recombinant Protein

Encompass Procurement Services
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Regulatory Status | RUO |
---|---|
Purity or Quality Grade | >80% by SDS-PAGE and Coomassie blue staining |
Conjugate | Unconjugated |
Form | Liquid |
Formulation | 1 M urea, PBS with no preservative; pH 7.4 |
Sequence | VSVIQFLEAPIGDEDAEEAAAEKRGLQRRATPHPSELKVMKRSIEGRRSEACPCQPDSGSPLPAEEEKRLSAESGLSEDSRPSASTVS |
Concentration | ≥5.0 mg/mL |
For Use With (Application) | Blocking Assay,Control |
Name | Human SCRIB (aa 445-532) Control Fragment |
Recombinant | Recombinant |
Invitrogen™ Human Calcyclin (aa 1-69) Control Fragment Recombinant Protein
Recombinant Protein

Encompass Procurement Services
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Regulatory Status | RUO |
---|---|
Purity or Quality Grade | >80% by SDS-PAGE and Coomassie blue staining |
Conjugate | Unconjugated |
Form | Liquid |
Formulation | 1 M urea, PBS with no preservative; pH 7.4 |
Sequence | MASEELQKDLEEVKVLLEKATRKRVRDALTAEKSKIETEIKNKMQQKSQKKAELLDNEKPAAVVAPITT |
Concentration | ≥5.0 mg/mL |
For Use With (Application) | Blocking Assay,Control |
Name | Human Calcyclin (aa 1-69) Control Fragment |
Recombinant | Recombinant |
Invitrogen™ Human SCP2 (aa 43-143) Control Fragment Recombinant Protein
Recombinant Protein

Encompass Procurement Services
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Regulatory Status | RUO |
---|---|
Purity or Quality Grade | >80% by SDS-PAGE and Coomassie blue staining |
Conjugate | Unconjugated |
Form | Liquid |
Formulation | 1 M urea, PBS with no preservative; pH 7.4 |
Sequence | GKKALADAQIPYSAVDQACVGYVFGDSTCGQRAIYHSLGMTGIPIINVNNNCATGSTALFMARQLIQGGVAECVLALGFEKMSKGSLGIKFSDRTIPTDKH |
Concentration | ≥5.0 mg/mL |
For Use With (Application) | Blocking Assay,Control |
Name | Human SCP2 (aa 43-143) Control Fragment |
Recombinant | Recombinant |
Invitrogen™ Human WDR77 Control Fragment Recombinant Protein
Recombinant Protein

Encompass Procurement Services
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Regulatory Status | RUO |
---|---|
Purity or Quality Grade | >80% by SDS-PAGE and Coomassie blue staining |
Conjugate | Unconjugated |
Form | Liquid |
Formulation | 1 M urea, PBS with no preservative; pH 7.4 |
Sequence | SEDCSIAVLDSSLSELFRSQAHRDFVRDATWSPLNHSLLTTVGWDHQVVHHVVPTEPLPAPGPASVTE |
Concentration | ≥5.0 mg/mL |
For Use With (Application) | Blocking Assay,Control |
Name | Human WDR77 Control Fragment |
Recombinant | Recombinant |
Invitrogen™ Human KIF21B (aa 1123-1199) Control Fragment Recombinant Protein
Recombinant Protein

Encompass Procurement Services
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Regulatory Status | RUO |
---|---|
Purity or Quality Grade | >80% by SDS-PAGE and Coomassie blue staining |
Conjugate | Unconjugated |
Form | Liquid |
Formulation | 1 M urea, PBS with no preservative; pH 7.4 |
Sequence | TMKGSTSHDDFKFKSEPKLSAQMKAVSAECLGPPLDISTKNITKSLASLVEIKEDGVGFSVRDPYYRDRVSRTVSLP |
Concentration | ≥5.0 mg/mL |
For Use With (Application) | Blocking Assay,Control |
Name | Human KIF21B (aa 1123-1199) Control Fragment |
Recombinant | Recombinant |
Invitrogen™ Human CCDC181 (aa 225-314) Control Fragment Recombinant Protein
Recombinant Protein

Encompass Procurement Services
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Regulatory Status | RUO |
---|---|
Purity or Quality Grade | >80% by SDS-PAGE and Coomassie blue staining |
Conjugate | Unconjugated |
Form | Liquid |
Formulation | 1 M urea, PBS with no preservative; pH 7.4 |
Sequence | FELLNLQDIASQGFLPPINNANSTENDPQQLLPRSSNSSVSGTKKEDSTAKIHAVTHSSTGEPLAYIAQPPLNRKTCPSSAVNSDRSKGN |
Concentration | ≥5.0 mg/mL |
For Use With (Application) | Blocking Assay,Control |
Name | Human CCDC181 (aa 225-314) Control Fragment |
Recombinant | Recombinant |
Invitrogen™ Human DHDDS (aa 251-333) Control Fragment Recombinant Protein
Recombinant Protein

Encompass Procurement Services
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Regulatory Status | RUO |
---|---|
Purity or Quality Grade | >80% by SDS-PAGE and Coomassie blue staining |
Conjugate | Unconjugated |
Form | Liquid |
Formulation | 1 M urea, PBS with no preservative; pH 7.4 |
Sequence | HSVLQKARDMYAEERKRQQLERDQATVTEQLLREGLQASGDAQLRRTRLHKLSARREERVQGFLQALELKRADWLARLGTASA |
Concentration | ≥5.0 mg/mL |
For Use With (Application) | Blocking Assay,Control |
Name | Human DHDDS (aa 251-333) Control Fragment |
Recombinant | Recombinant |
Invitrogen™ Human TEKT2 (aa 36-131) Control Fragment Recombinant Protein
Recombinant Protein

Encompass Procurement Services
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Regulatory Status | RUO |
---|---|
Purity or Quality Grade | >80% by SDS-PAGE and Coomassie blue staining |
Conjugate | Unconjugated |
Form | Liquid |
Formulation | 1 M urea, PBS with no preservative; pH 7.4 |
Sequence | HQIRQEARVLRNETNNQTIWDEHDNRTRLVERIDTVNRWKEMLDKCLTDLDAEIDALTQMKESAEQNLQAKNLPLDVAIECLTLRESRRDIDVVKD |
Concentration | ≥5.0 mg/mL |
For Use With (Application) | Blocking Assay,Control |
Name | Human TEKT2 (aa 36-131) Control Fragment |
Recombinant | Recombinant |
Invitrogen™ Human MIIP (aa 307-388) Control Fragment Recombinant Protein
Recombinant Protein

Encompass Procurement Services
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Regulatory Status | RUO |
---|---|
Purity or Quality Grade | >80% by SDS-PAGE and Coomassie blue staining |
Conjugate | Unconjugated |
Form | Liquid |
Formulation | 1 M urea, PBS with no preservative; pH 7.4 |
Sequence | SDTLALPRHCLLGWDIFPPKSEKSSAPRNLDLWSSVSAEAQHQKLSGTSSPFHPASPMQMLPPTPTWSVPQVPRPHVPRQKP |
Concentration | ≥5.0 mg/mL |
For Use With (Application) | Blocking Assay,Control |
Name | Human MIIP (aa 307-388) Control Fragment |
Recombinant | Recombinant |
Invitrogen™ Human SIPA1L2 (aa 1377-1460) Control Fragment Recombinant Protein
Recombinant Protein

Encompass Procurement Services
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Regulatory Status | RUO |
---|---|
Purity or Quality Grade | >80% by SDS-PAGE and Coomassie blue staining |
Conjugate | Unconjugated |
Form | Liquid |
Formulation | 1 M urea, PBS with no preservative; pH 7.4 |
Sequence | QQVPGSMSKPYHRQGAVNKYVIGWKKSEGSPPPEEPEVTECPGMYSEMDVMSTATQHQTVVGDAVAETQHVLSKEDFLKLMLPD |
Concentration | ≥5.0 mg/mL |
For Use With (Application) | Blocking Assay,Control |
Name | Human SIPA1L2 (aa 1377-1460) Control Fragment |
Recombinant | Recombinant |
Invitrogen™ Human RAB3GAP2 (aa 192-284) Control Fragment Recombinant Protein
Recombinant Protein

Encompass Procurement Services
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Regulatory Status | RUO |
---|---|
Purity or Quality Grade | >80% by SDS-PAGE and Coomassie blue staining |
Conjugate | Unconjugated |
Form | Liquid |
Formulation | 1 M urea, PBS with no preservative; pH 7.4 |
Sequence | TYEIPRHPGVTEQNEELSILYPAAIVTIDGFSLFQSLRACRNQVAKAAASGNENIQPPPLAYKKWGLQDIDTIIDHASVGIMTLSPFDQMKTA |
Concentration | ≥5.0 mg/mL |
For Use With (Application) | Blocking Assay,Control |
Name | Human RAB3GAP2 (aa 192-284) Control Fragment |
Recombinant | Recombinant |